Protein Domain ID: d1ryia1
Superfamily ID: c.3.1
Number of Sequences: 72
Sequence Length: 276
Structurally conserved residues: 85
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271
| | | | | | | | | | | | | | | | | | | | | | | | | | | |
12446******99***********999*******999999466666654442112211121222222224444444433220000023445554311111111011111000000000000000000111110111111122334444678999998899988889***98****9***8765******************987665665566666664321235666255666666655565556666666666666665222111111100000
d1ryia1: MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNADGKPYIGRHPEDSRILFAAGHFRNGILLAPATGA