Protein Domain ID: d1so2a_
Superfamily ID: a.211.1
Number of Sequences: 19
Sequence Length: 363
Structurally conserved residues: 93
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341 351 361
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
0111212233333222222234443311110013332233554443333333333344444467889989999988876****************983110111110000000000000000001125555544437*************9*88776566644444322224455777888***9**997232245553222222666799998888886633445544332222210002222222234458************98776433666766644444442333333332233332222233566666677876577778666544777631000001112888877788877665
d1so2a_: LDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDR