Protein Domain ID: d1txda1
Superfamily ID: a.87.1
Number of Sequences: 8
Sequence Length: 234
Structurally conserved residues: 172
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231
| | | | | | | | | | | | | | | | | | | | | | | |
11112222332222556656*********************************878****8***************************887555688**68*8*7**76277***83*****************8**757888**********667668***************************8****88***************8***7887753222222221111111
d1txda1: PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSL
d1dbha1: -------------------