Protein Domain ID: d1ujna_
Superfamily ID: e.22.1
Number of Sequences: 7
Sequence Length: 338
Structurally conserved residues: 292
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
2222222*88*****************************************8********8825***8*********88***422**********************88************22*******************8**************************************************8********************7511111488**4*************747********************488************************8*******48**84222222278*************888742222211
d1ujna_: MQRLEVREPVPYPILVGEGVLKEVPPLAGPAALLFDRRVEGFAQEVAKALGVRHLLGLPGGEAAKSLEVYGKVLSWLAEKGLPRNATLLVVGGGTLTDLGGFVAATYLRGVAYLAFPTTTLAIVDASVGGKTGINLPEGKNLVGAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDEALLKVEDLTPQSPRLEAFLARAVAVKVRVTEEDPLEKGKRRLLNLGHTLGHALEAQTRHALPHGMAV