Protein Domain ID: d1uwva2
Superfamily ID: c.66.1
Number of Sequences: 103
Sequence Length: 357
Structurally conserved residues: 134
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341 351
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
00000000000000000000000000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000111111111100000000000000000000000000000000000000111111122333333333334444322236789999988889888799999999999999999999999999999999999999999866788899999999578885534777999*****9978799999*999999999***999899888899988887788979999986654567999999998
d1uwva2: ERETPRCPHFGVCGGCQQQHASVDLQQRSKSAALARLMKHDVSEVIADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCPILAPQLEALLPKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDSEILETVSGEMPWYDSNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQ