Protein Domain ID: d1v7wa2
Superfamily ID: b.30.5
Number of Sequences: 22
Sequence Length: 270
Structurally conserved residues: 134
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261
| | | | | | | | | | | | | | | | | | | | | | | | | | |
000111111011111110133788999898888999998788999986645588666443222221579999884436776653221344332234599999999*******9999*********6479*********98522699*********8833211011110155579**99999*****7654210057*****9**995799798863255550000111111111111111158997*9**8*9754479**********5
d1v7wa2: MKYGYFDNDNREYVITRPDVPAPWTNYLGTEKFCTVISHNAGGYSFYNSPEYNRVTKFRPNATFDRPGHYVYLRDDDSGDYWSISWQPVAKSLDEAQYQIRHGLSYSKFQCDYNGIHARKTLFVPKGEDAEIWDVVIKNTSDQVRTISAFSFVEFSFSHIQSDNQNHQMSLYSAGTAYRPGLIEYDLYYNTDDFEGFYYLASTFDPDSYDGQRDRFLGLYRDEANPLAVEQGRCSNSAQTCYNHCGSLHKQ