Protein Domain ID: d1w4xa2
Superfamily ID: c.3.1
Number of Sequences: 73
Sequence Length: 235
Structurally conserved residues: 64
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231
| | | | | | | | | | | | | | | | | | | | | | | |
0000022233321012333333322133332259999999999999999999998989999998776522222000000000000000000000000000000100000000000000000000000001233333322111233333333333444332221000000000000000111223233356777767568999991069999999999999999999999999987
d1w4xa2: VPQLPNFPGLKDFAGNLYHTGNWPHEPVDFSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFAVPARNAPLDPEFLADLKKRYAEFREESRNTPGGTHRYQGPKSALEVSDEELVETLERYWQEGGPDILAAYRDILRDRDANERVAEFIRNKIRNTVRDPEVAERLVPKGYPFGTKRLILEIDYYEMFNRDNVHLVDTLSAPIETITPRGVRTSEREYELDSLVLATGF
d1djqa2: cltHDPIPGADaslpDQ