Protein Domain ID: d1wvfa1
Superfamily ID: d.58.32
Number of Sequences: 5
Sequence Length: 279
Structurally conserved residues: 216
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271
| | | | | | | | | | | | | | | | | | | | | | | | | | | |
**********8668***********88888****6******888888824444444444444444444666688868**********6468***8888888886686888888846888844666666668886888**8666688888*********8888***88****8*****8***8*******88**********8444468************************88668******88*************8888***8****888866444
d1wvfa1: PVFKPFEVIFEDEADIVEIVDALRPLRMSNTIPNSVVIASTLWEAGSAHLTRAQYTTEPGHTPDSVIKQMQKDTGMGAWNLYAALYGTQEQVDVNWKIVTDVFKKLGKGRIVTQEEAGDTQPFKYRAQLMSGVPNLQEFGLYNWRGGGGSMWFAPVSEARGSECKKQAAMAKRVLHKYGLDYVAEFIVAPRDMHHVIDVLYDRTNPEETKRADACFNELLDEFEKEGYAVYRVNTRFQDRVAQSYGPVKRK