Protein Domain ID: d1wz8a1
Superfamily ID: c.14.1
Number of Sequences: 28
Sequence Length: 263
Structurally conserved residues: 146
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261
| | | | | | | | | | | | | | | | | | | | | | | | | | |
33355567799****68999*9***9878899****99999999999*9896799******5556*****97657643344445677778999999*********************9****999******88*****98898866665556566666666666666678999*888888888*******9898899998888887787665555655555555553222222222322222222222222221111100000
d1wz8a1: LASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEFLGFSGKELEEGLK