Protein Domain ID: d1xgka_
Superfamily ID: c.2.1
Number of Sequences: 97
Sequence Length: 325
Structurally conserved residues: 101
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
1689******879*********999999******998743788888887689999665424569999889999******96545568999999999987897579**99864333100022333445787888999999999999985533332220001122211000000011121111122323344235555555555565443444455555422111111111111100000000000000000000000000000000000000011110000000000000122222221111111111110111100000000000
d1xgka_: QQKKTIAVVGATGRQGASLIRVAAAVGHHVRAQVHSLKGLIAEELQAIPNVTLFQGPLLNNVPLMDTLFEGAHLAFINTTSQAGDEIAIGKDLADAAKRAGTIQHYIYSSMPDHSLYGPWPAVPMWAPKFTVENYVRQLGLPSTFVYAGIYNNNFTSLPYPLFQMELMPDGTFEWHAPFDPDIPLPWLDAEHDVGPALLQIFKDGPQKWNGHRIALTFETLSPVQVCAAFSRALNRRVTYVQVPKVEIKVNIP