Protein Domain ID: d1xnga1
Superfamily ID: c.26.2
Number of Sequences: 28
Sequence Length: 255
Structurally conserved residues: 82
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251
| | | | | | | | | | | | | | | | | | | | | | | | | |
222223333333333333222368******989**9**9*****9**658*******96678888*******888**9******96555544433322233345667777999***99*987789****998555456667776643449988855556656666655666543333432212222110112222211111111111000000111111000000000000001111000000000001111100
d1xnga1: KDYQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQTKPIDTETLAQLGYDEILVKNITSRIQKNAFKLELPAIAK