Protein Domain ID: d1xtta1
Superfamily ID: c.61.1
Number of Sequences: 27
Sequence Length: 215
Structurally conserved residues: 106
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211
| | | | | | | | | | | | | | | | | | | | | |
11222223344444554456543245777888888888878788772100000000000000000334435*******999************5*******8566542110010146789789988999713*********999************99999***********96799995552267**999999522211114555433344444
d1xtta1: PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
d1nula_: ------------eKYIV---------TWDMLQIHARK