Protein Domain ID: d1yp2a2
Superfamily ID: c.68.1
Number of Sequences: 32
Sequence Length: 293
Structurally conserved residues: 136
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
112222221589*****344443234899975551469**********9*999******89897699999875543479999996211112467*998****999999655689*****99*98**999*98999975589******976643433455553332233344344453333455422100000000000111457899******9999**996568987777768799997776989****9977999988776555554443211132343311011111000
d1yp2a2: QTCLDPDASRSVLGIILRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYDG