Protein Domain ID: d2afwa1
Superfamily ID: c.56.5
Number of Sequences: 33
Sequence Length: 323
Structurally conserved residues: 142
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
0000000000000011101112222233445666615677766665555336677788777777774367888887433100011347778888883677999999999996543321233576657*************9998875430139********86874322333367999****998631110000001456679********52568******9889*********99887610000110111399993799768898899998779*******42267786666684336*9999999*********9*9771
d2afwa1: ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEG