Protein Domain ID: d2nxfa1
Superfamily ID: d.159.1
Number of Sequences: 23
Sequence Length: 314
Structurally conserved residues: 130
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
356***********3222210000000002345***9****99*9988*99*********873311112555999*99***987689*********8546767988799997710012333336667777745555566664334443221000000000000000000000000000000000000111233554555554555554214579*******876531233467776877999*986667*******9*9*9****93888*****8**98642369*******755799999995122333321
d2nxfa1: DPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVL