Protein Domain ID: d2q02a1
Superfamily ID: c.1.15
Number of Sequences: 11
Sequence Length: 271
Structurally conserved residues: 229
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271
| | | | | | | | | | | | | | | | | | | | | | | | | | | |
022279******778998*99*****************956222678999****************8******99995999****************9*********88889****999*******88*99***********88*****9********99************99*9*9*8567658***************854545888729*****57877********88799**********66667776779*99*9********9
d2q02a1: MNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASW