Citrus Sinensis ID: 000052


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------2090------2100------2110------2120------2130------2140------2150------2160------2170------2180------2190------2200------2210------2220------2230------2240------2250------2260------2270------2280------2290------2300------2310------2320------2330------2340------2350------2360------2370------2380------2390------2400------2410------2420------2430------2440------2450------2460------2470------2480------2490------2500------2510------2520------2530------2540------2550------2560------2570------2580------2590--
MDPVNTPSNSAPHPPPEETEYLARYLVVKHSWRGRYKRILCISNATIITLDPNTLAVTNSYEVASDFEGATPIIGRDDNANEFNISVRTDGRGKFKAFKFSSRFRASILTELHRIRWVRLNAVAEFPVLHLRRRNSEWVPYKLKVTYVGVELTDLRSGDLRWCLDFRDMDSPAIVLLSDAYGKRSETGGFVLCPLYGRKSKAFQAAPGTTNSAIVSSLTKTAKSMVGLSLSVDSSQPLSVAEYIKRRAKEAVGADETPCGGWSVTRLRSAAHGTLNVSGLSLGIGPKGGLGEHGGAVSRQLILTRVSLVERRPDNYEAVIVRPLSAVSSLVRFAEEPQMFAIEFNDGCPIHVYASTSRDSLLAAVRDVLQTEGHYPVPVLPRLTMPGHRIDPPCGVVHMQVRKQRPVADMESTSMHLKHLAAVAKDAVAESGQVSGSRAKLWRRIREFNACIPYSGVPPSVEVPEVTLMALITMLPSTPNLPPESPPLPPPSPKAAATVMGFVACLRRLLTSRTAASHVMSFPAAVGRIMGLLRNGSEGVAAEAAGLIAILIGGGSGDTNMLTDSKGEQHATMMHTKSVLFSQQGYLIVLVNRLRPMSVSPLLSMAVVEVLETMICEPHSETTQYTVFVELLRQVAGLRRRLFALFGHPAESVRETVAVIMRTIAEEDAIAAESMRDAALRDGALLRHLLHAFFLPAGERREVSRQLVALWADSYQPALDLLSRVLPPGLVAYLHTRSDGVLSEDANLEGSLTSRRQRRLLQQRKGRPGRGIASQEHSVPYVNNVEANDPTRQKTSAFRGPGSHQTSNLDPSSGQASAFQSPAARSGENLVSDIPYMGFSQNDHPAVVATADSPLRGVHESLDPKATSSVDSDANAVGFQNTDIPAPAQVVVESTPVGSGRLLLNWPEFWRAFSLDHNRADLVWNERTRQELREALQAEVHKLDVEKERTEDIVPGGATLETMTGQDSVPQISWNYPEFSVSYPSLSKEVCVGQYYLRLLLESGSSGRAQDFPLRDPVAFFRALYHRFLCDADIGLTVDGAIPDELGASDDWCDMGRLDGFGGGGGSSVRELCARAMAIVYEQHYTTIGPFEGTAHITVLLDRTDDRALRHRLLLLLKVLMKVLANIEACVLVGGCVLAVDLLTVVHETSERTAIPLQSNLLAATAFMEPFKEWMFIDKDGAQVGPVEKDAIRRFWSKKAIDWTTRCWASGMLDWKKLRDIRELRWALAVRVPVLTPTQVGEAALAILHNMVSAHSDLDDAGEIVTPTPRVKWILSSSRCLPHIAQAMLSGEPSIVEAAAALLKAVVTRNPKAMIRLYSTGAFYFALAYPGSNLYSIAQLFSVTHVHQAFHGGEEAAVSSSLPLAKRSVLGGLLPESLLYVLERSGPAAFSAAMVSDSDTPEIIWTHKMRAENLIRQVLQHLGDFPQKLSQHCHSLYEYAPMPPVTYPELKDEMWCHRYYLRNLCDEIQFPNWPIVEHVEFLQSLLVMWREELTRRPMDLSEEEACKILEISLDDVSSDDSHKSYSSEEMSNISKKIENIDEEKLKRQYRKLAMKYHPDKNPEGREKFLAVQKAYERLQATMQGLQGPQPWRLLLLLKGQCILYRRYGDVLEPFKYAGYPMLLNAVTVDEDDNNFLSSDRAPLLVAASELLWLTCASSSLNGEELVRDGGIQLLSTLLSRCMCVVQKTTPAMEPSAVIVTNVMRTFSVLSQFESARTEVLQFSGLVQDIVHCTELELVPGAVDAALQTIAHVSVSSELQDALLKAGALWFLLPLLLQYDSTAEKSDTNESHGVGASVQIAKNMHAVRAAQALSRLSGLCSNGISIPYNEAAASALRALLTPKLASLLKDQIPKNLLSKLNTNLESPEIIWNSSTRAELLKFVDQQRASQSPDGSYDLKDSNGFLYEALSKELYVGNVYLRVYNDQPDFEITEPEAFCVALIDFISYLVHNQSATKSDVQGEESLDGLSSKIVQDKLSLDPSSSKTFELPSDATDSSMNERKVNDESLAVSDRKVTGKEDSVMIKNLQFGLTSLQNILTSNPNLASIFSTKEKLLPLFECFSVPFAPDSNIPQLCLNVLSLLTTCASCLEAMVADGSSLLLLLQMLHYAPACREGVLHVLYALASTPELAWAAAKHGGVVYILELLLPSQQETPLQQRAAAASLLGKLVGQPMHGPRVAITLARFLPDGLVSVIRDGPGEAVVSALEQTTETPELVWTPAMAASLSAQISTMASDLYREQMKGRVVDWDVPEQASAQQEMRDEPQVGGIYVRLFLKDPKFPLRNPKRFLEGLLDQYLSSIAATHYDTQAIDPELPLLLSAALVSLLRVHPALADHVGYLGYVPKLVAAVAYEGRRETMSTEEVKNGNSEADRTYESDDGSAQPVQTPQERVRLSCLRVLHQLAASTTCAEAMAATSTGTPQVVPILMKAIGWQGGSILALETLKRVVVAGNRARDALVAQGLKVGLVDVLLGLLDWRAGGRNGLSSQMKWNESEASIGRVLAIEVLHAFAAEGAHCSKVRDILSASDVWSAYKDQKHDLFLPSNAQSAAAGVAGLIESSSSRLPYALTAPPQSSHPRPPSTAFDSNGMHDQLS
cccccccccccccccccccccEEEEEEEEEcccccccEEEEEEccEEEEEccccccccccccccccccccccccccccccccEEEEEEEccccccccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcEEEEECcccccEEEEEccccccccEEEEEccccccccccccEEEEcccccccccHHccccccHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHcccccccccccCEEEEEEccccccccccccccccccccccccccccccEEEEEcccEEEEEcccccccEEEEEcccEEEEEEccccccEEEEEEccccccEEEccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHcccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccHHHHHHcccHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEccccccccEEccEEEEEEEcccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHccccccccccEEEEEcccccCCccccHHHHHHHHHcccccccccEEEcccccHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccHHHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccHHHHHHHHcccHHHHHHHHcccccccEEcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccEEccEEHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*******************EYLARYLVVKHSWRGRYKRILCISNATIITLDPNTLAVTNSYEVASDFEGATPIIGRDDNANEFNISVRTDGRGKFKAFKFSSRFRASILTELHRIRWVRLNAVAEFPVLHLRRRNSEWVPYKLKVTYVGVELTDLRSGDLRWCLDFRDMDSPAIVLLSDAYGKRSETGGFVLCPLYGRKSKAFQAAPGTTNSAIVSSLTKTAKSMVGLSLSVDSSQPLSVAEYIKRRAKEAVGADETPCGGWSVTRLRSAAHGTLNVSGLSLGIGPKGGLGEHGGAVSRQLILTRVSLVERRPDNYEAVIVRPLSAVSSLVRFAEEPQMFAIEFNDGCPIHVYASTSRDSLLAAVRDVLQTEGHYPVPVLPRLTMPGHRIDPPCGVVHMQVRKQRPVADMESTSMHLKHLAAVAKDAVA**GQVSGSRAKLWRRIREFNACIPYSGVPPSVEVPEVTLMALITMLPSTPN*************KAAATVMGFVACLRRLLTSRTAASHVMSFPAAVGRIMGLLRNGSEGVAAEAAGLIAILIGGGSGDT*************MMHTKSVLFSQQGYLIVLVNRLRPMSVSPLLSMAVVEVLETMICEPHSETTQYTVFVELLRQVAGLRRRLFALFGHPAESVRETVAVIMRTIAEEDAIAAESMRDAALRDGALLRHLLHAFFLPAGERREVSRQLVALWADSYQPALDLLSRVLPPGLVAYLHTRS*************************************************************************************************************************************************IPAPAQVVVESTPVGSGRLLLNWPEFWRAFSLDHNRADLVWNERTRQELREALQAEVHKLDVEKERTED**************DSVPQISWNYPEFSVSYPSLSKEVCVGQYYLRLLLESGSSGRAQDFPLRDPVAFFRALYHRFLCDADIGLTVDGAIPDELGASDDWCDMGRLDGF**GGGSSVRELCARAMAIVYEQHYTTIGPFEGTAHITVLLDRTDDRALRHRLLLLLKVLMKVLANIEACVLVGGCVLAVDLLTVVHETSERTAIPLQSNLLAATAFMEPFKEWMFIDKDGAQVGPVEKDAIRRFWSKKAIDWTTRCWASGMLDWKKLRDIRELRWALAVRVPVLTPTQVGEAALAILHNMVSAHSDLDDAGEIVTPTPRVKWILSSSRCLPHIAQAMLSGEPSIVEAAAALLKAVVTRNPKAMIRLYSTGAFYFALAYPGSNLYSIAQLFSVTHVHQAFHGG*****SSSLPLAKRSVLGGLLPESLLYVLERSGPAAFSAAMVSDSDTPEIIWTHKMRAENLIRQVLQHLGDFPQKLSQHCHSLYEYAPMPPVTYPELKDEMWCHRYYLRNLCDEIQFPNWPIVEHVEFLQSLLVMWREELTR*********ACKILEI**********************SKKIENIDEEKLKRQYRKLAMKYHPDKNPEGREKFLAVQKAYERLQATMQGLQGPQPWRLLLLLKGQCILYRRYGDVLEPFKYAGYPMLLNAVTVDEDDNNFLSSDRAPLLVAASELLWLTCASSSLNGEELVRDGGIQLLSTLLSRCMCVVQKTTPAMEPSAVIVTNVMRTFSVLSQFESARTEVLQFSGLVQDIVHCTELELVPGAVDAALQTIAHVSVSSELQDALLKAGALWFLLPLLLQYDSTAE*************VQIAKNMHAVRAAQALSRLSGLCSNGISIPYNEAAASALRALLTPKLASLLKDQIPKNLLSKLNTNLESPEIIWNSSTRAELLKFVDQ**********YDLKDSNGFLYEALSKELYVGNVYLRVYNDQPDFEITEPEAFCVALIDFISYLVHNQSA*****QGEESLDGLSSKIVQDKLSLDPSSSKTFELPSDATDSSMNERKVNDESLAVSDRKVTGKEDSVMIKNLQFGLTSLQNILTSNPNLASIFSTKEKLLPLFECFSVPFAPDSNIPQLCLNVLSLLTTCASCLEAMVADGSSLLLLLQMLHYAPACREGVLHVLYALASTPELAWAAAKHGGVVYILELLLPSQQETPLQQRAAAASLLGKLVGQPMHGPRVAITLARFLPDGLVSVIRDGPGEAVVSALEQTTETPELVWTPAMAASLSAQISTMASDLYREQMKGRVVDWDVPEQASAQQEMRDEPQVGGIYVRLFLKDPKFPLRNPKRFLEGLLDQYLSSIAATHYDTQAIDPELPLLLSAALVSLLRVHPALADHVGYLGYVPKLVAAVAYEGRRETMSTEE*KN***********************ERVRLSCLRVLHQLAASTTCAEAMAATSTGTPQVVPILMKAIGWQGGSILALETLKRVVVAGNRARDALVAQGLKVGLVDVLLGLLDWRAGGRNGLSSQMKWNESEASIGRVLAIEVLHAFAAEGAHCSKVRDILSASDVWSAYKDQKHDLFLPSNAQSAAAGVAGLIE************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPVNTPSNSAPHPPPEETEYLARYLVVKHSWRGRYKRILCISNATIITLDPNTLAVTNSYEVASDFEGATPIIGRDDNANEFNISVRTDGRGKFKAFKFSSRFRASILTELHRIRWVRLNAVAEFPVLHLRRRNSEWVPYKLKVTYVGVELTDLRSGDLRWCLDFRDMDSPAIVLLSDAYGKRSETGGFVLCPLYGRKSKAFQAAPGTTNSAIVSSLTKTAKSMVGLSLSVDSSQPLSVAEYIKRRAKEAVGADETPCGGWSVTRLRSAAHGTLNVSGLSLGIGPKGGLGEHGGAVSRQLILTRVSLVERRPDNYEAVIVRPLSAVSSLVRFAEEPQMFAIEFNDGCPIHVYASTSRDSLLAAVRDVLQTEGHYPVPVLPRLTMPGHRIDPPCGVVHMQVRKQRPVADMESTSMHLKHLAAVAKDAVAESGQVSGSRAKLWRRIREFNACIPYSGVPPSVEVPEVTLMALITMLPSTPNLPPESPPLPPPSPKAAATVMGFVACLRRLLTSRTAASHVMSFPAAVGRIMGLLRNGSEGVAAEAAGLIAILIGGGSGDTNMLTDSKGEQHATMMHTKSVLFSQQGYLIVLVNRLRPMSVSPLLSMAVVEVLETMICEPHSETTQYTVFVELLRQVAGLRRRLFALFGHPAESVRETVAVIMRTIAEEDAIAAESMRDAALRDGALLRHLLHAFFLPAGERREVSRQLVALWADSYQPALDLLSRVLPPGLVAYLHTRSDGVLSEDANLEGSLTSRRQRRLLQQRKGRPGRGIASQEHSVPYVNNVEANDPTRQKTSAFRGPGSHQTSNLDPSSGQASAFQSPAARSGENLVSDIPYMGFSQNDHPAVVATADSPLRGVHESLDPKATSSVDSDANAVGFQNTDIPAPAQVVVESTPVGSGRLLLNWPEFWRAFSLDHNRADLVWNERTxxxxxxxxxxxxxxxxxxxxxxxxxVPGGATLETMTGQDSVPQISWNYPEFSVSYPSLSKEVCVGQYYLRLLLESGSSGRAQDFPLRDPVAFFRALYHRFLCDADIGLTVDGAIPDELGASDDWCDMGRLDGFGGGGGSSVRELCARAMAIVYEQHYTTIGPFEGTAHITVLLDRTDDRALRHRLLLLLKVLMKVLANIEACVLVGGCVLAVDLLTVVHETSERTAIPLQSNLLAATAFMEPFKEWMFIDKDGAQVGPVEKDAIRRFWSKKAIDWTTRCWASGMLDWKKLRDIRELRWALAVRVPVLTPTQVGEAALAILHNMVSAHSDLDDAGEIVTPTPRVKWILSSSRCLPHIAQAMLSGEPSIVEAAAALLKAVVTRNPKAMIRLYSTGAFYFALAYPGSNLYSIAQLFSVTHVHQAFHGGEEAAVSSSLPLAKRSVLGGLLPESLLYVLERSGPAAFSAAMVSDSDTPEIIWTHKMRAENLIRQVLQHLGDFPQKLSQHCHSLYEYAPMPPVTYPELKDEMWCHRYYLRNLCDEIQFPNWPIVEHVEFLQSLLVMWREELTRRPMDLSEEEACKILEISLDDVSSDDSHKSYSSEEMSNISKKIENIDEEKLKRQYRKLAMKYHPDKNPEGREKFLAVQKAYERLQATMQGLQGPQPWRLLLLLKGQCILYRRYGDVLEPFKYAGYPMLLNAVTVDEDDNNFLSSDRAPLLVAASELLWLTCASSSLNGEELVRDGGIQLLSTLLSRCMCVVQKTTPAMEPSAVIVTNVMRTFSVLSQFESARTEVLQFSGLVQDIVHCTELELVPGAVDAALQTIAHVSVSSELQDALLKAGALWFLLPLLLQYDSTAEKSDTNESHGVGASVQIAKNMHAVRAAQALSRLSGLCSNGISIPYNEAAASALRALLTPKLASLLKDQIPKNLLSKLNTNLESPEIIWNSSTRAELLKFVDQQRASQSPDGSYDLKDSNGFLYEALSKELYVGNVYLRVYNDQPDFEITEPEAFCVALIDFISYLVHNQSATKSDVQGEESLDGLSSKIVQDKLSLDPSSSKTFELPSDATDSSMNERKVNDESLAVSDRKVTGKEDSVMIKNLQFGLTSLQNILTSNPNLASIFSTKEKLLPLFECFSVPFAPDSNIPQLCLNVLSLLTTCASCLEAMVADGSSLLLLLQMLHYAPACREGVLHVLYALASTPELAWAAAKHGGVVYILELLLPSQQETPLQQRAAAASLLGKLVGQPMHGPRVAITLARFLPDGLVSVIRDGPGEAVVSALEQTTETPELVWTPAMAASLSAQISTMASDLYREQMKGRVVDWDVPEQASAQQEMRDEPQVGGIYVRLFLKDPKFPLRNPKRFLEGLLDQYLSSIAATHYDTQAIDPELPLLLSAALVSLLRVHPALADHVGYLGYVPKLVAAVAYEGRRETMSTEEVKNGNSEADRTYESDDGSAQPVQTPQERVRLSCLRVLHQLAASTTCAEAMAATSTGTPQVVPILMKAIGWQGGSILALETLKRVVVAGNRARDALVAQGLKVGLVDVLLGLLDWRAGGRNGLSSQMKWNESEASIGRVLAIEVLHAFAAEGAHCSKVRDILSASDVWSAYKDQKHDLFLPSNAQSAAAGVAGLIESSSSRLPYALTAPPQSSHPRPPSTAFDSNGMHDQLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily C GRV2 Required for endosome formation, vacuolar protein sorting and determination of the embryo growth axis; necessary for the transport of proteins into protein storage vacuoles (PSVs). Participates to vesicle trafficking from the endosome to the central vacuole. Involved in the regulation of shoot phototropism and gravitropism, probably through the positioning of specialized amyloplasts (statoliths) in endodermal cells.confidentF4IVL6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 2026-2353,2387-2475
View the alignment between query and template
View the model in PyMOL
Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 2052-2185,2199-2266,2290-2352,2388-2477,2493-2511
View the alignment between query and template
View the model in PyMOL
Template: 2CTR, chain A
Confidence level:very confident
Coverage over the Query: 1499-1513,1539-1582,1600-1610
View the alignment between query and template
View the model in PyMOL
Template: 2Z6G, chain A
Confidence level:confident
Coverage over the Query: 1667-1680,1692-1779,1797-1851,1872-1892,1903-1913,1932-1952,2019-2185,2199-2278,2302-2352,2388-2448
View the alignment between query and template
View the model in PyMOL
Template: 2Z6H, chain A
Confidence level:confident
Coverage over the Query: 1643-1681,1695-1778,1796-1850,1871-1900,1933-1953,2019-2183,2195-2248
View the alignment between query and template
View the model in PyMOL
Template: 2Z6H, chain A
Confidence level:confident
Coverage over the Query: 2026-2258,2270-2365,2380-2476,2493-2513
View the alignment between query and template
View the model in PyMOL
Template: 3OPB, chain A
Confidence level:probable
Coverage over the Query: 2027-2251,2278-2286,2307-2352,2388-2532
View the alignment between query and template
View the model in PyMOL
Template: 1WH2, chain A
Confidence level:probable
Coverage over the Query: 1169-1224
View the alignment between query and template
View the model in PyMOL
Template: 3GRL, chain A
Confidence level:probable
Coverage over the Query: 501-558,575-725
View the alignment between query and template
View the model in PyMOL
Template: 3OQS, chain A
Confidence level:probable
Coverage over the Query: 1637-1680,1693-1787,1808-1853
View the alignment between query and template
View the model in PyMOL