BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000063
         (2469 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NFQ|A Chain A, Crystal Structure Of The Conserved Central Domain Of Yeast
            Spn1IWS1
 pdb|3NFQ|B Chain B, Crystal Structure Of The Conserved Central Domain Of Yeast
            Spn1IWS1
          Length = 170

 Score = 32.0 bits (71), Expect = 4.2,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 1643 KRTIRSEDDVDASLQSGVVRVFEQPGIEAPSDEDDFIEVRSKRQMLNDRREQKEKEIKAK 1702
            +RT R EDD++  L   ++R+ ++  I A  D D           LN R E  +  + A 
Sbjct: 1    RRTRRDEDDLEQYLDEKILRLKDEXNIAAQLDID----------TLNKRIETGDTSLIAX 50

Query: 1703 SRVTKLPK 1710
             +V  LPK
Sbjct: 51   QKVKLLPK 58


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.128    0.369 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 67,397,246
Number of Sequences: 62578
Number of extensions: 2782749
Number of successful extensions: 3807
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 3807
Number of HSP's gapped (non-prelim): 7
length of query: 2469
length of database: 14,973,337
effective HSP length: 115
effective length of query: 2354
effective length of database: 7,776,867
effective search space: 18306744918
effective search space used: 18306744918
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)