BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 000064
(2464 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NFQ|A Chain A, Crystal Structure Of The Conserved Central Domain Of Yeast
Spn1IWS1
pdb|3NFQ|B Chain B, Crystal Structure Of The Conserved Central Domain Of Yeast
Spn1IWS1
Length = 170
Score = 32.0 bits (71), Expect = 4.1, Method: Composition-based stats.
Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 10/68 (14%)
Query: 1643 KRTIRSEDDVDASLQSGVVRVFEQPGIEAPSDEDDFIEVRSKRQMLNDRREQKEKEIKAK 1702
+RT R EDD++ L ++R+ ++ I A D D LN R E + + A
Sbjct: 1 RRTRRDEDDLEQYLDEKILRLKDEXNIAAQLDID----------TLNKRIETGDTSLIAX 50
Query: 1703 SRVTKLPK 1710
+V LPK
Sbjct: 51 QKVKLLPK 58
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.128 0.370
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 67,198,654
Number of Sequences: 62578
Number of extensions: 2772949
Number of successful extensions: 3797
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 3797
Number of HSP's gapped (non-prelim): 7
length of query: 2464
length of database: 14,973,337
effective HSP length: 115
effective length of query: 2349
effective length of database: 7,776,867
effective search space: 18267860583
effective search space used: 18267860583
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)