Query 000153
Match_columns 2021
No_of_seqs 362 out of 1477
Neff 3.4
Searched_HMMs 46136
Date Thu Mar 28 20:56:34 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/000153.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/000153hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG0163 Myosin class VI heavy 99.2 9.4E-11 2E-15 143.4 12.0 25 839-863 1167-1191(1259)
2 KOG1029 Endocytic adaptor prot 98.8 1.1E-07 2.3E-12 118.1 18.4 35 558-592 309-346 (1118)
3 PF07001 BAT2_N: BAT2 N-termin 98.6 2.9E-07 6.2E-12 101.5 10.6 69 8-102 16-84 (189)
4 PTZ00121 MAEBL; Provisional 98.4 2E-06 4.4E-11 111.9 14.6 9 83-91 604-612 (2084)
5 KOG1029 Endocytic adaptor prot 98.4 7.7E-06 1.7E-10 102.2 17.4 17 74-91 87-103 (1118)
6 PTZ00121 MAEBL; Provisional 98.3 1.1E-05 2.3E-10 105.6 18.3 21 404-426 881-901 (2084)
7 KOG4364 Chromatin assembly fac 98.2 0.00012 2.6E-09 91.3 23.2 44 808-853 491-536 (811)
8 PTZ00266 NIMA-related protein 98.0 4E-05 8.8E-10 101.1 14.9 24 933-956 781-804 (1021)
9 PTZ00266 NIMA-related protein 98.0 5.3E-05 1.2E-09 100.0 15.5 15 52-66 25-39 (1021)
10 PRK09510 tolA cell envelope in 97.8 0.0011 2.5E-08 80.4 19.7 7 884-890 363-369 (387)
11 KOG4364 Chromatin assembly fac 97.7 0.0005 1.1E-08 86.0 16.2 21 1272-1292 750-770 (811)
12 KOG2891 Surface glycoprotein [ 97.6 0.0025 5.5E-08 73.7 18.1 8 388-395 157-164 (445)
13 COG3064 TolA Membrane protein 97.4 0.0061 1.3E-07 71.9 18.5 9 913-921 362-370 (387)
14 COG3064 TolA Membrane protein 97.4 0.0031 6.7E-08 74.2 15.8 14 838-851 326-339 (387)
15 KOG0163 Myosin class VI heavy 97.4 0.0018 3.8E-08 81.9 14.6 30 849-878 1213-1242(1259)
16 KOG4661 Hsp27-ERE-TATA-binding 97.4 0.0077 1.7E-07 74.6 19.2 43 833-879 769-814 (940)
17 KOG2891 Surface glycoprotein [ 97.3 0.0038 8.3E-08 72.3 14.7 10 553-562 277-286 (445)
18 PRK09510 tolA cell envelope in 97.3 0.015 3.2E-07 71.1 20.4 20 902-921 349-368 (387)
19 KOG0742 AAA+-type ATPase [Post 97.2 0.038 8.2E-07 67.7 21.7 23 721-743 252-274 (630)
20 TIGR02794 tolA_full TolA prote 97.2 0.021 4.5E-07 69.0 19.8 10 842-851 289-298 (346)
21 PF05262 Borrelia_P83: Borreli 97.2 0.0073 1.6E-07 75.4 15.9 12 469-480 107-119 (489)
22 KOG2072 Translation initiation 96.9 0.14 3.1E-06 66.6 23.4 13 762-774 897-909 (988)
23 KOG4661 Hsp27-ERE-TATA-binding 96.8 0.0081 1.8E-07 74.4 11.8 21 235-256 255-275 (940)
24 KOG2412 Nuclear-export-signal 96.6 0.077 1.7E-06 66.6 17.9 33 806-838 420-452 (591)
25 KOG1144 Translation initiation 96.4 0.011 2.4E-07 75.7 9.8 34 1101-1142 707-740 (1064)
26 PF05262 Borrelia_P83: Borreli 96.4 0.079 1.7E-06 66.7 16.6 12 877-888 477-488 (489)
27 KOG2412 Nuclear-export-signal 96.2 0.11 2.5E-06 65.2 16.4 44 817-860 409-457 (591)
28 PF12037 DUF3523: Domain of un 95.6 1 2.2E-05 53.7 20.1 8 537-544 26-33 (276)
29 KOG4817 Unnamed protein [Funct 94.9 0.56 1.2E-05 57.0 15.5 65 8-96 15-79 (468)
30 PF09726 Macoilin: Transmembra 94.7 0.7 1.5E-05 60.8 16.9 9 188-196 196-204 (697)
31 KOG3054 Uncharacterized conser 94.5 0.3 6.5E-06 56.8 11.4 11 758-768 246-256 (299)
32 KOG0742 AAA+-type ATPase [Post 94.3 1.4 3E-05 54.9 16.7 8 537-544 70-77 (630)
33 KOG4722 Zn-finger protein [Gen 94.2 0.88 1.9E-05 56.0 14.7 27 449-476 188-214 (672)
34 TIGR03319 YmdA_YtgF conserved 93.9 0.88 1.9E-05 58.0 15.0 6 780-785 249-254 (514)
35 PRK00106 hypothetical protein; 93.8 0.82 1.8E-05 58.6 14.5 6 780-785 270-275 (535)
36 PF00769 ERM: Ezrin/radixin/mo 93.6 3.4 7.3E-05 48.4 17.9 15 574-588 9-23 (246)
37 PRK00106 hypothetical protein; 93.3 5.5 0.00012 51.4 20.4 7 767-773 273-279 (535)
38 PF09726 Macoilin: Transmembra 93.1 2.2 4.8E-05 56.3 17.1 9 174-182 132-140 (697)
39 PRK12705 hypothetical protein; 90.8 7.5 0.00016 50.0 17.5 13 547-559 21-33 (508)
40 COG4942 Membrane-bound metallo 89.2 15 0.00033 46.3 17.8 6 787-792 358-363 (420)
41 KOG1103 Predicted coiled-coil 88.6 5.3 0.00011 48.7 12.9 42 959-1011 450-491 (561)
42 KOG3654 Uncharacterized CH dom 88.6 2.4 5.1E-05 53.5 10.3 20 201-220 115-134 (708)
43 KOG0579 Ste20-like serine/thre 87.2 12 0.00025 49.2 15.2 8 347-354 575-582 (1187)
44 KOG0579 Ste20-like serine/thre 85.7 33 0.00073 45.4 18.0 11 183-193 473-483 (1187)
45 PF02029 Caldesmon: Caldesmon; 85.4 3.2 7E-05 52.9 9.4 15 875-889 459-473 (492)
46 PF12128 DUF3584: Protein of u 85.1 18 0.00039 50.8 17.0 7 1228-1234 1167-1173(1201)
47 PRK00409 recombination and DNA 84.8 27 0.00059 47.2 17.8 11 841-851 734-744 (782)
48 KOG3634 Troponin [Cytoskeleton 84.2 12 0.00026 45.9 12.6 9 721-729 266-274 (361)
49 TIGR01069 mutS2 MutS2 family p 84.1 25 0.00055 47.4 17.0 13 277-289 217-229 (771)
50 PRK00409 recombination and DNA 83.7 24 0.00053 47.6 16.7 12 277-288 222-233 (782)
51 PF09731 Mitofilin: Mitochondr 83.0 81 0.0018 40.9 20.4 7 319-325 27-33 (582)
52 TIGR01069 mutS2 MutS2 family p 82.4 31 0.00068 46.6 16.8 8 843-850 725-732 (771)
53 KOG1265 Phospholipase C [Lipid 82.2 54 0.0012 44.8 18.1 15 318-333 752-767 (1189)
54 PLN03086 PRLI-interacting fact 82.0 7.8 0.00017 50.4 10.8 10 816-825 185-194 (567)
55 KOG0161 Myosin class II heavy 80.8 53 0.0011 48.4 18.8 12 498-509 699-710 (1930)
56 PTZ00491 major vault protein; 80.8 37 0.0008 46.2 16.3 10 150-159 198-207 (850)
57 KOG1103 Predicted coiled-coil 80.6 59 0.0013 40.3 16.5 10 500-509 55-64 (561)
58 KOG3654 Uncharacterized CH dom 80.0 11 0.00025 47.8 10.8 17 75-91 17-33 (708)
59 KOG2689 Predicted ubiquitin re 79.8 14 0.00031 44.3 11.1 6 803-808 254-259 (290)
60 KOG2507 Ubiquitin regulatory p 79.6 4.4 9.4E-05 50.7 7.2 8 907-914 464-471 (506)
61 PF06098 Radial_spoke_3: Radia 78.9 18 0.00038 44.0 11.7 15 335-349 2-16 (291)
62 KOG4848 Extracellular matrix-a 77.1 1.5E+02 0.0032 34.7 17.3 11 469-479 71-81 (225)
63 PF06637 PV-1: PV-1 protein (P 76.5 62 0.0013 40.7 15.3 10 723-732 419-428 (442)
64 PLN02316 synthase/transferase 76.4 30 0.00065 48.2 14.1 24 768-791 509-534 (1036)
65 KOG0982 Centrosomal protein Nu 75.1 2.2E+02 0.0047 36.8 19.4 12 549-560 225-236 (502)
66 KOG0994 Extracellular matrix g 74.6 1.1E+02 0.0024 43.0 17.8 63 162-231 1193-1260(1758)
67 KOG2689 Predicted ubiquitin re 73.2 29 0.00062 42.0 11.2 12 810-821 250-261 (290)
68 KOG3634 Troponin [Cytoskeleton 73.2 26 0.00055 43.2 10.9 7 679-685 204-210 (361)
69 KOG0681 Actin-related protein 72.6 23 0.0005 46.0 10.8 6 469-474 149-154 (645)
70 KOG1265 Phospholipase C [Lipid 71.5 1.7E+02 0.0037 40.4 18.3 10 399-408 795-804 (1189)
71 PTZ00491 major vault protein; 71.1 93 0.002 42.7 16.2 9 150-158 145-153 (850)
72 KOG1363 Predicted regulator of 70.2 25 0.00055 45.0 10.6 11 291-301 63-73 (460)
73 KOG0161 Myosin class II heavy 69.9 1.4E+02 0.0031 44.4 18.5 9 185-193 302-310 (1930)
74 KOG0994 Extracellular matrix g 69.6 87 0.0019 44.0 15.2 11 52-62 645-655 (1758)
75 COG2433 Uncharacterized conser 69.5 1E+02 0.0022 40.9 15.5 12 453-464 266-277 (652)
76 KOG2441 mRNA splicing factor/p 68.5 34 0.00074 42.9 10.7 49 730-785 395-444 (506)
77 KOG0982 Centrosomal protein Nu 67.6 2.6E+02 0.0056 36.2 17.8 15 492-506 170-184 (502)
78 KOG0288 WD40 repeat protein Ti 66.6 2.8E+02 0.006 35.8 17.8 21 723-743 156-176 (459)
79 PRK13428 F0F1 ATP synthase sub 66.6 1.4E+02 0.003 38.2 16.0 7 841-847 258-264 (445)
80 KOG3756 Pinin (desmosome-assoc 64.8 3.6E+02 0.0079 33.7 18.1 6 381-386 58-63 (340)
81 PRK04863 mukB cell division pr 64.0 2.6E+02 0.0057 41.0 19.3 11 1288-1298 830-840 (1486)
82 PF10168 Nup88: Nuclear pore c 63.8 1.7E+02 0.0036 39.9 16.5 15 81-95 83-97 (717)
83 KOG0933 Structural maintenance 63.0 3.6E+02 0.0078 38.1 18.9 18 537-554 662-679 (1174)
84 KOG0681 Actin-related protein 62.6 44 0.00095 43.6 10.4 6 281-286 23-28 (645)
85 KOG4572 Predicted DNA-binding 62.5 1.4E+02 0.0031 40.5 14.9 15 69-84 229-243 (1424)
86 KOG0921 Dosage compensation co 62.0 13 0.00029 50.2 6.2 25 36-60 1204-1232(1282)
87 KOG2668 Flotillins [Intracellu 61.6 3.4E+02 0.0073 34.5 17.0 8 741-748 398-405 (428)
88 PRK04863 mukB cell division pr 61.0 2.5E+02 0.0054 41.3 18.2 37 839-876 730-768 (1486)
89 PRK12472 hypothetical protein; 60.8 1.1E+02 0.0023 39.9 13.2 8 515-522 136-143 (508)
90 PF05914 RIB43A: RIB43A; Inte 60.8 4.5E+02 0.0098 33.5 19.1 14 541-554 140-153 (379)
91 PF10168 Nup88: Nuclear pore c 60.4 3.9E+02 0.0085 36.6 19.0 9 449-457 395-403 (717)
92 TIGR02680 conserved hypothetic 58.1 3.3E+02 0.0071 39.6 18.7 6 361-366 57-62 (1353)
93 PRK12472 hypothetical protein; 57.1 1.9E+02 0.0041 37.8 14.5 9 908-916 480-488 (508)
94 COG2433 Uncharacterized conser 56.8 1.1E+02 0.0024 40.6 12.6 6 308-313 99-104 (652)
95 TIGR02680 conserved hypothetic 56.6 3.2E+02 0.007 39.7 18.3 11 1496-1506 1246-1256(1353)
96 KOG4722 Zn-finger protein [Gen 54.8 4.6E+02 0.0099 33.9 16.7 17 189-205 82-98 (672)
97 TIGR02169 SMC_prok_A chromosom 54.8 5E+02 0.011 36.1 19.1 9 779-787 573-581 (1164)
98 PF05667 DUF812: Protein of un 53.8 4.1E+02 0.0089 35.7 17.3 9 187-195 47-55 (594)
99 KOG3915 Transcription regulato 53.1 1.5E+02 0.0032 38.3 12.4 20 36-55 71-90 (641)
100 KOG0976 Rho/Rac1-interacting s 53.1 3.8E+02 0.0083 37.0 16.4 13 1534-1546 1197-1209(1265)
101 PF06936 Selenoprotein_S: Sele 53.0 77 0.0017 36.7 9.5 6 524-529 17-22 (190)
102 PRK03918 chromosome segregatio 52.1 7E+02 0.015 34.1 19.6 12 347-358 30-41 (880)
103 KOG0288 WD40 repeat protein Ti 51.6 6.7E+02 0.014 32.6 17.9 15 997-1011 383-397 (459)
104 TIGR02169 SMC_prok_A chromosom 51.0 6.1E+02 0.013 35.2 19.0 6 350-355 33-38 (1164)
105 KOG2894 Uncharacterized conser 50.3 1.7E+02 0.0037 35.8 11.9 10 729-738 256-265 (331)
106 KOG0612 Rho-associated, coiled 48.9 3.5E+02 0.0075 38.9 15.7 27 424-450 309-335 (1317)
107 PF15359 CDV3: Carnitine defic 48.7 44 0.00095 36.6 6.4 63 116-193 59-123 (129)
108 COG5269 ZUO1 Ribosome-associat 46.8 2.2E+02 0.0048 34.9 12.1 13 724-736 341-353 (379)
109 KOG0612 Rho-associated, coiled 46.0 7.6E+02 0.016 35.9 18.1 15 1315-1329 1205-1220(1317)
110 KOG2129 Uncharacterized conser 45.9 7.7E+02 0.017 32.1 16.8 28 866-893 473-500 (552)
111 KOG0980 Actin-binding protein 45.6 7.5E+02 0.016 34.8 17.6 8 526-533 312-319 (980)
112 KOG3973 Uncharacterized conser 44.4 37 0.0008 42.1 5.6 29 71-99 310-338 (465)
113 KOG2441 mRNA splicing factor/p 44.3 46 0.001 41.9 6.4 9 732-740 412-420 (506)
114 COG1196 Smc Chromosome segrega 43.9 1.1E+03 0.023 34.1 19.9 18 858-875 600-617 (1163)
115 KOG0996 Structural maintenance 43.8 8.7E+02 0.019 35.2 18.1 7 1228-1234 1168-1174(1293)
116 KOG3915 Transcription regulato 42.1 1.7E+02 0.0038 37.8 10.8 8 177-184 178-185 (641)
117 KOG0976 Rho/Rac1-interacting s 40.7 1.2E+03 0.026 32.7 18.0 23 1269-1296 971-993 (1265)
118 PLN03188 kinesin-12 family pro 40.5 1.4E+03 0.03 33.7 19.4 23 407-429 671-693 (1320)
119 PF12004 DUF3498: Domain of un 38.5 10 0.00022 48.7 0.0 8 379-386 236-243 (495)
120 KOG0971 Microtubule-associated 37.9 5.5E+02 0.012 36.1 14.7 15 1328-1342 1108-1122(1243)
121 KOG3973 Uncharacterized conser 35.5 26 0.00056 43.3 2.6 20 36-55 441-460 (465)
122 KOG0249 LAR-interacting protei 34.7 6E+02 0.013 35.0 14.1 12 912-923 440-451 (916)
123 KOG0250 DNA repair protein RAD 34.7 1.4E+03 0.03 33.1 17.9 31 887-918 617-650 (1074)
124 COG4499 Predicted membrane pro 34.6 90 0.002 39.5 6.9 21 548-568 347-367 (434)
125 COG1196 Smc Chromosome segrega 32.5 1.8E+03 0.038 32.0 19.4 8 779-786 567-574 (1163)
126 COG0419 SbcC ATPase involved i 31.7 1.6E+03 0.035 31.4 19.5 11 349-359 34-44 (908)
127 KOG0345 ATP-dependent RNA heli 29.9 2.1E+02 0.0046 37.5 9.0 15 373-387 349-363 (567)
128 KOG2505 Ankyrin repeat protein 29.6 2.2E+02 0.0047 37.4 9.0 8 213-220 103-110 (591)
129 KOG0804 Cytoplasmic Zn-finger 29.1 9.5E+02 0.021 31.6 14.2 113 595-707 329-443 (493)
130 COG5269 ZUO1 Ribosome-associat 28.7 7.2E+02 0.016 30.9 12.5 12 271-282 16-27 (379)
131 PF00901 Orbi_VP5: Orbivirus o 28.6 1.6E+03 0.034 30.1 17.9 10 551-560 89-98 (508)
132 KOG3598 Thyroid hormone recept 28.0 1.5E+02 0.0031 42.8 7.6 12 376-387 1924-1935(2220)
133 KOG0577 Serine/threonine prote 28.0 1.2E+03 0.027 32.0 15.2 14 261-274 210-223 (948)
134 KOG3598 Thyroid hormone recept 26.8 1.6E+02 0.0035 42.5 7.7 6 153-158 1772-1777(2220)
135 KOG4715 SWI/SNF-related matrix 25.4 1.9E+02 0.0042 35.9 7.3 12 279-290 25-36 (410)
136 PLN03188 kinesin-12 family pro 25.3 2.2E+03 0.047 31.9 17.6 12 70-81 65-76 (1320)
137 KOG0249 LAR-interacting protei 24.4 1.6E+03 0.035 31.3 15.4 21 1486-1506 816-836 (916)
138 KOG3878 Protein involved in ma 24.3 1.5E+03 0.033 28.9 14.3 7 768-774 301-307 (469)
139 PF03154 Atrophin-1: Atrophin- 23.8 43 0.00093 46.0 1.9 8 756-763 667-674 (982)
140 KOG0971 Microtubule-associated 22.9 2.4E+03 0.053 30.5 19.1 32 308-351 46-78 (1243)
141 KOG4466 Component of histone d 22.4 1.6E+03 0.034 28.1 14.8 6 780-785 194-199 (291)
142 PF03154 Atrophin-1: Atrophin- 21.1 56 0.0012 45.0 2.1 9 902-910 790-798 (982)
143 KOG0979 Structural maintenance 21.0 2.7E+03 0.059 30.3 18.4 17 185-201 347-363 (1072)
144 PF07111 HCR: Alpha helical co 20.3 2.5E+03 0.053 29.5 18.0 135 563-699 78-212 (739)
No 1
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=99.18 E-value=9.4e-11 Score=143.36 Aligned_cols=25 Identities=24% Similarity=0.466 Sum_probs=23.0
Q ss_pred ccCCcccccCCCCccccccccCccc
Q 000153 839 SRGQRWNMSGDGDHYGRNIEMESDF 863 (2021)
Q Consensus 839 ~~p~~W~apgDGd~igRq~E~dSd~ 863 (2021)
.+.+|||+||||+||.|||++|++-
T Consensus 1167 ~k~gmWyaHFdGq~I~RQm~l~~~k 1191 (1259)
T KOG0163|consen 1167 TKRGMWYAHFDGQWIARQMELHPDK 1191 (1259)
T ss_pred CccceEEEecCcHHHHhhheecCCC
Confidence 6789999999999999999999863
No 2
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.81 E-value=1.1e-07 Score=118.05 Aligned_cols=35 Identities=40% Similarity=0.548 Sum_probs=26.0
Q ss_pred cccccccchhhhhHH---HHHHHHHHHHHHHHHHHHHH
Q 000153 558 LKQTDFHDPVRESFE---AELERVQKMQEQERQRIIEE 592 (2021)
Q Consensus 558 lkq~e~EeKrREe~E---aELERreKeqEEERKReEEE 592 (2021)
.....||+|++++++ +||+|+++.++++.+|+.++
T Consensus 309 P~~~TFEDKrkeNy~kGqaELerRRq~leeqqqreree 346 (1118)
T KOG1029|consen 309 PAPVTFEDKRKENYEKGQAELERRRQALEEQQQREREE 346 (1118)
T ss_pred CCCcchhhhhHHhHhhhhHHHHHHHHHHHHHHHHHHHH
Confidence 445779999999998 88998777777666554443
No 3
>PF07001 BAT2_N: BAT2 N-terminus; InterPro: IPR009738 This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2. BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [].
Probab=98.56 E-value=2.9e-07 Score=101.54 Aligned_cols=69 Identities=35% Similarity=0.485 Sum_probs=47.8
Q ss_pred cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeeccCccccccCCccccCCCCCCCcccccc
Q 000153 8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH 87 (2021)
Q Consensus 8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh 87 (2021)
.||.++|||..|--.+.--+ -....-..||.+|++= +.. --||||.||||||.||
T Consensus 16 ~Ky~~l~in~~YkGks~e~q------------------k~~~~~~hGmqsLGKv------~~a-RRmPpPaNLPSLKaEn 70 (189)
T PF07001_consen 16 PKYSSLNINSLYKGKSLEPQ------------------KSTVPRRHGMQSLGKV------PSA-RRMPPPANLPSLKAEN 70 (189)
T ss_pred ccceeechhhhhcCCccccc------------------cCCccCCCcceecccc------ccc-ccCCCCCCCcchhhhc
Confidence 38999999999933332210 0122237799999982 111 1289999999999999
Q ss_pred cccCCCCCCCCCCCC
Q 000153 88 ERFDSSGSNGGPAGG 102 (2021)
Q Consensus 88 ~~~d~~~~~~~~~~~ 102 (2021)
.++|++-.. +|.+|
T Consensus 71 ~GnDpnv~l-VP~~G 84 (189)
T PF07001_consen 71 KGNDPNVSL-VPKGG 84 (189)
T ss_pred cCCCCCcee-ecCCC
Confidence 999977766 56543
No 4
>PTZ00121 MAEBL; Provisional
Probab=98.42 E-value=2e-06 Score=111.90 Aligned_cols=9 Identities=56% Similarity=0.663 Sum_probs=5.6
Q ss_pred ccccccccC
Q 000153 83 LRKEHERFD 91 (2021)
Q Consensus 83 lrkeh~~~d 91 (2021)
--+.-+|||
T Consensus 604 q~~~m~rfd 612 (2084)
T PTZ00121 604 QQKFMERFD 612 (2084)
T ss_pred HHHHHHhcC
Confidence 445666777
No 5
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.37 E-value=7.7e-06 Score=102.25 Aligned_cols=17 Identities=47% Similarity=0.677 Sum_probs=9.3
Q ss_pred cCCCCCCCcccccccccC
Q 000153 74 VPPPLNLPSLRKEHERFD 91 (2021)
Q Consensus 74 vp~plnlpslrkeh~~~d 91 (2021)
||+-|- |||-|---+|-
T Consensus 87 lP~~LP-Psll~~~~~~~ 103 (1118)
T KOG1029|consen 87 LPPVLP-PSLLKQPPRNA 103 (1118)
T ss_pred CCCCCC-hHHhccCCcCC
Confidence 344333 56777666655
No 6
>PTZ00121 MAEBL; Provisional
Probab=98.35 E-value=1.1e-05 Score=105.61 Aligned_cols=21 Identities=19% Similarity=0.158 Sum_probs=9.1
Q ss_pred CccccCCccccccccccccccCc
Q 000153 404 GICERPSSLNREANKETKFMSSP 426 (2021)
Q Consensus 404 GigvRp~S~~R~~tKe~kY~~sp 426 (2021)
..|.+| +.-...|+=-|+++-
T Consensus 881 p~Cf~p--~Kt~~~KnwtYvSSf 901 (2084)
T PTZ00121 881 PNCQII--RKTLDSKDWTYVSSF 901 (2084)
T ss_pred Cccccc--ccccccccceeeccc
Confidence 444444 333444444444443
No 7
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=98.24 E-value=0.00012 Score=91.35 Aligned_cols=44 Identities=18% Similarity=0.296 Sum_probs=27.6
Q ss_pred CcccCCCCCcccccCccccccccc--cccccccccCCcccccCCCCcc
Q 000153 808 RKEFYGGPGIMSSRNYYKAGILEP--HMDEFTVSRGQRWNMSGDGDHY 853 (2021)
Q Consensus 808 r~efyggagFvsK~PY~~gGttD~--hLdDY~~~~p~~W~apgDGd~i 853 (2021)
|..|||.|+--++ .+.++.+-. .+.||.++.+..|-....|.-+
T Consensus 491 RP~YyGTWrKKS~--~VsarrPlAq~~llDYEVdSDeEWEEEepGESl 536 (811)
T KOG4364|consen 491 RPGYYGTWRKKSQ--VVSARRPLAQDPLLDYEVDSDEEWEEEEPGESL 536 (811)
T ss_pred CCccccccccccc--ccccCCcccccccccccccCcccccccCCCccc
Confidence 4678888764333 355544433 5568888888888766666533
No 8
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=98.04 E-value=4e-05 Score=101.13 Aligned_cols=24 Identities=29% Similarity=0.173 Sum_probs=13.6
Q ss_pred CCcCCCCCCccccccccccccccc
Q 000153 933 RENECPSPSTFQENEVEYNRLLRS 956 (2021)
Q Consensus 933 ~~~~~p~ps~f~~~~~~~~~~~r~ 956 (2021)
.++.-|+=++=+--++.|+|.-+.
T Consensus 781 ~~~~~~~~~~~~~~~~~~~~~~~~ 804 (1021)
T PTZ00266 781 KEAVNPICSAEAHYERVYNHGNRG 804 (1021)
T ss_pred hhhccchhccCCchhccccCCccc
Confidence 344555555545566667665554
No 9
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=98.03 E-value=5.3e-05 Score=100.05 Aligned_cols=15 Identities=20% Similarity=0.286 Sum_probs=9.2
Q ss_pred CCceEEeeccCcccc
Q 000153 52 GGGMLVLSRPRSSQK 66 (2021)
Q Consensus 52 ~ggm~vlsr~r~~~~ 66 (2021)
+=|.|.|.+.+.+..
T Consensus 25 gFGtVYLAkdk~tg~ 39 (1021)
T PTZ00266 25 RFGEVFLVKHKRTQE 39 (1021)
T ss_pred CCeEEEEEEECCCCe
Confidence 445677777665543
No 10
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.79 E-value=0.0011 Score=80.36 Aligned_cols=7 Identities=29% Similarity=0.349 Sum_probs=2.9
Q ss_pred CCCCCCC
Q 000153 884 NVHPPYP 890 (2021)
Q Consensus 884 rp~PP~p 890 (2021)
.++|++|
T Consensus 363 a~lP~pP 369 (387)
T PRK09510 363 AKIPKPP 369 (387)
T ss_pred CCCCCCC
Confidence 4444443
No 11
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.75 E-value=0.0005 Score=86.02 Aligned_cols=21 Identities=29% Similarity=0.199 Sum_probs=12.4
Q ss_pred CCccceEEEeecccCCCCCCC
Q 000153 1272 QAETPVKLQFGLFSGPSLIPS 1292 (2021)
Q Consensus 1272 ~~e~pv~lqfglfsgpslips 1292 (2021)
+.-++|+-|+-.-.||+--|.
T Consensus 750 ~~~lqv~~qw~y~l~~~~sp~ 770 (811)
T KOG4364|consen 750 DSRLQVKKQWLYKLGLSPSPD 770 (811)
T ss_pred cccccccceeeeeecCCCCCC
Confidence 456677777766666554333
No 12
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.62 E-value=0.0025 Score=73.69 Aligned_cols=8 Identities=13% Similarity=0.110 Sum_probs=4.5
Q ss_pred ccccCccc
Q 000153 388 LQKDGFGA 395 (2021)
Q Consensus 388 l~K~w~~a 395 (2021)
|+-.||.-
T Consensus 157 ip~kwf~l 164 (445)
T KOG2891|consen 157 IPCKWFAL 164 (445)
T ss_pred Ccceeeee
Confidence 45557754
No 13
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.45 E-value=0.0061 Score=71.86 Aligned_cols=9 Identities=22% Similarity=0.770 Sum_probs=3.5
Q ss_pred CCCCCCCCC
Q 000153 913 RHPRVLPPP 921 (2021)
Q Consensus 913 rqprvlppp 921 (2021)
|+-.||+||
T Consensus 362 k~~kiP~pp 370 (387)
T COG3064 362 KTAKIPKPP 370 (387)
T ss_pred HhccCCCCC
Confidence 333344433
No 14
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.42 E-value=0.0031 Score=74.21 Aligned_cols=14 Identities=21% Similarity=0.295 Sum_probs=6.0
Q ss_pred cccCCcccccCCCC
Q 000153 838 VSRGQRWNMSGDGD 851 (2021)
Q Consensus 838 ~~~p~~W~apgDGd 851 (2021)
+.|.-.+-.-.||.
T Consensus 326 K~C~l~ikL~pdGt 339 (387)
T COG3064 326 KTCRLRIKLAPDGT 339 (387)
T ss_pred ceeEEEEEEcCCcc
Confidence 34444444444444
No 15
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=97.42 E-value=0.0018 Score=81.88 Aligned_cols=30 Identities=23% Similarity=0.195 Sum_probs=17.9
Q ss_pred CCCccccccccCcccccccccccCCccccC
Q 000153 849 DGDHYGRNIEMESDFHENITERYGDVGWGQ 878 (2021)
Q Consensus 849 DGd~igRq~E~dSd~~~n~~erfGdsgW~~ 878 (2021)
.|.+-.|--||-+.=|+..-+|+|+-.+-.
T Consensus 1213 TgL~rKrGAEI~~~eFe~~W~r~Ggk~~~~ 1242 (1259)
T KOG0163|consen 1213 TGLTRKRGAEILEHEFEREWERNGGKAYKN 1242 (1259)
T ss_pred hccccccccccChHHHHHHHHHhCcHHhHh
Confidence 345555555665555555558888765554
No 16
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=97.39 E-value=0.0077 Score=74.60 Aligned_cols=43 Identities=19% Similarity=0.292 Sum_probs=23.7
Q ss_pred ccccccccCCcccccCCCCccccccccC---cccccccccccCCccccCC
Q 000153 833 MDEFTVSRGQRWNMSGDGDHYGRNIEME---SDFHENITERYGDVGWGQG 879 (2021)
Q Consensus 833 LdDY~~~~p~~W~apgDGd~igRq~E~d---Sd~~~n~~erfGdsgW~~s 879 (2021)
--||+.....+-+-|.+|+++......+ +++|-+ + .--+|+..
T Consensus 769 s~DrregSrsmmgd~regqHyp~~~~~hGGp~erHgr--d--srdGwgGy 814 (940)
T KOG4661|consen 769 SNDRREGSRSMMGDYREGQHYPLSGTVHGGPSERHGR--D--SRDGWGGY 814 (940)
T ss_pred ccccccccccccccchhhcccCccCccCCCchhhccC--c--cCCCcccc
Confidence 4456666666666666777666663333 344444 2 23367763
No 17
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.32 E-value=0.0038 Score=72.29 Aligned_cols=10 Identities=20% Similarity=0.388 Sum_probs=3.8
Q ss_pred hhhhhccccc
Q 000153 553 KKKDVLKQTD 562 (2021)
Q Consensus 553 KKKEelkq~e 562 (2021)
|..++.++.+
T Consensus 277 kraeerrqie 286 (445)
T KOG2891|consen 277 KRAEERRQIE 286 (445)
T ss_pred HHHHHHhhhh
Confidence 3334333333
No 18
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.31 E-value=0.015 Score=71.06 Aligned_cols=20 Identities=10% Similarity=0.257 Sum_probs=10.5
Q ss_pred cccccccccccCCCCCCCCC
Q 000153 902 ISSFGRSRYSMRHPRVLPPP 921 (2021)
Q Consensus 902 ~~s~~r~rys~rqprvlppp 921 (2021)
...|||.=.....-.+||+|
T Consensus 349 d~aldrAA~~Aar~a~lP~p 368 (387)
T PRK09510 349 DPALCQAALAAAKTAKIPKP 368 (387)
T ss_pred CHHHHHHHHHHHHcCCCCCC
Confidence 34678754444333445544
No 19
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=97.19 E-value=0.038 Score=67.70 Aligned_cols=23 Identities=26% Similarity=0.351 Sum_probs=13.8
Q ss_pred hhhhhhhhccccCCCCCCCCCCc
Q 000153 721 DGERMVERITTSASSDSSGLHRS 743 (2021)
Q Consensus 721 D~ERmVERI~TSSSsDSs~~NR~ 743 (2021)
+.+..++.|+|.-+.=-..++-+
T Consensus 252 eRekwl~aInTtf~higgG~r~~ 274 (630)
T KOG0742|consen 252 EREKWLEAINTTFTHIGGGLRAF 274 (630)
T ss_pred HHHHHHHHHhhhHHHhhhHHHHH
Confidence 45567888888765544433333
No 20
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=97.19 E-value=0.021 Score=69.00 Aligned_cols=10 Identities=30% Similarity=0.508 Sum_probs=4.3
Q ss_pred CcccccCCCC
Q 000153 842 QRWNMSGDGD 851 (2021)
Q Consensus 842 ~~W~apgDGd 851 (2021)
-.+.+..||.
T Consensus 289 V~I~L~pdG~ 298 (346)
T TIGR02794 289 LRIRLAPDGT 298 (346)
T ss_pred EEEEECCCCC
Confidence 3344444443
No 21
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=97.15 E-value=0.0073 Score=75.44 Aligned_cols=12 Identities=33% Similarity=0.454 Sum_probs=6.5
Q ss_pred ccccccccc-ccC
Q 000153 469 QYGSEQYNR-FRG 480 (2021)
Q Consensus 469 ~yg~~qy~r-YrG 480 (2021)
+.||-.||- |||
T Consensus 107 A~fit~YNAv~R~ 119 (489)
T PF05262_consen 107 ATFITIYNAVYRG 119 (489)
T ss_pred HHHHHHHHHHHcC
Confidence 455666664 444
No 22
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=96.85 E-value=0.14 Score=66.59 Aligned_cols=13 Identities=38% Similarity=0.654 Sum_probs=8.1
Q ss_pred cCCCCCCcccccc
Q 000153 762 DRGKPFNSWRRDA 774 (2021)
Q Consensus 762 dR~K~~nswrR~~ 774 (2021)
.|.-+.+.|+|-.
T Consensus 897 ~~a~~~~~WrR~a 909 (988)
T KOG2072|consen 897 PRAPEEAEWRRGA 909 (988)
T ss_pred CCCCcchHHhhcc
Confidence 3444566788876
No 23
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.80 E-value=0.0081 Score=74.42 Aligned_cols=21 Identities=10% Similarity=-0.023 Sum_probs=13.8
Q ss_pred CCCcccccCCCcccCCccccCC
Q 000153 235 DGMSPRLQSGQDVVGSRLRENG 256 (2021)
Q Consensus 235 ~~m~pq~~~~~~~~g~~~~~~~ 256 (2021)
--..|-+.+-+.+.|.+ ++++
T Consensus 255 aeeedlfdSahpeegDl-Dlas 275 (940)
T KOG4661|consen 255 AEEEDLFDSAHPEEGDL-DLAS 275 (940)
T ss_pred hhccccccccCCccccc-cccc
Confidence 34566677778888876 5444
No 24
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=96.57 E-value=0.077 Score=66.58 Aligned_cols=33 Identities=6% Similarity=-0.054 Sum_probs=26.4
Q ss_pred CCCcccCCCCCcccccCcccccccccccccccc
Q 000153 806 VPRKEFYGGPGIMSSRNYYKAGILEPHMDEFTV 838 (2021)
Q Consensus 806 ppr~efyggagFvsK~PY~~gGttD~hLdDY~~ 838 (2021)
||+.--...+.+.|+|||..++.++...++|.+
T Consensus 420 ~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k 452 (591)
T KOG2412|consen 420 FPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQK 452 (591)
T ss_pred CchHHHHHHHHHHhcCCccccccccCcHHHHHH
Confidence 566666677889999999999988877777753
No 25
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.43 E-value=0.011 Score=75.72 Aligned_cols=34 Identities=24% Similarity=0.245 Sum_probs=15.4
Q ss_pred ccCCCCCcccccchhhhhcccccccCCCCcccceeeeccCce
Q 000153 1101 EDVPEGDDENIELTQEFEGIHLEEKGSPHMMSNLVLGFNEGV 1142 (2021)
Q Consensus 1101 ed~~~~~den~~l~~e~~~~hl~~k~~p~~~~~~vlgf~egv 1142 (2021)
.-.|++--.-||.- +.|.-| |+=|-+|||=-.|-
T Consensus 707 VKvieG~GtTIDVi--LvNG~L------~eGD~IvvcG~~Gp 740 (1064)
T KOG1144|consen 707 VKVIEGHGTTIDVI--LVNGEL------HEGDQIVVCGLQGP 740 (1064)
T ss_pred EEeecCCCceEEEE--EEccee------ccCCEEEEcCCCCc
Confidence 33444445566543 233332 33356666543443
No 26
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=96.37 E-value=0.079 Score=66.65 Aligned_cols=12 Identities=0% Similarity=-0.153 Sum_probs=5.9
Q ss_pred cCCCCCCCCCCC
Q 000153 877 GQGRYRGNVHPP 888 (2021)
Q Consensus 877 ~~ssS~~rp~PP 888 (2021)
+.|.-...||.|
T Consensus 477 a~S~~eV~P~T~ 488 (489)
T PF05262_consen 477 AKSEVEVLPFTS 488 (489)
T ss_pred hcCccccCCCCC
Confidence 344555555544
No 27
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=96.19 E-value=0.11 Score=65.19 Aligned_cols=44 Identities=5% Similarity=-0.033 Sum_probs=28.7
Q ss_pred cccccCccccccccc---cccccccccCCcccccCCCC--ccccccccC
Q 000153 817 IMSSRNYYKAGILEP---HMDEFTVSRGQRWNMSGDGD--HYGRNIEME 860 (2021)
Q Consensus 817 FvsK~PY~~gGttD~---hLdDY~~~~p~~W~apgDGd--~igRq~E~d 860 (2021)
|.+.+.|+--.++|- .|+.+++.||=...++-+.+ ...+.|+|.
T Consensus 409 la~V~l~i~~q~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~mGyk 457 (591)
T KOG2412|consen 409 LAKVILYIWSQFPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMMGYK 457 (591)
T ss_pred HHHHHHHHHHhCchHHHHHHHHHHhcCCccccccccCcHHHHHHhhccc
Confidence 446666666666665 77999999976666555555 444555553
No 28
>PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif.
Probab=95.63 E-value=1 Score=53.66 Aligned_cols=8 Identities=38% Similarity=0.463 Sum_probs=4.7
Q ss_pred CCCCCCcc
Q 000153 537 FDGRDPFS 544 (2021)
Q Consensus 537 fDG~Dpf~ 544 (2021)
..+|||..
T Consensus 26 ~~~FDP~a 33 (276)
T PF12037_consen 26 ASGFDPEA 33 (276)
T ss_pred cCCCCcHH
Confidence 44677663
No 29
>KOG4817 consensus Unnamed protein [Function unknown]
Probab=94.94 E-value=0.56 Score=57.00 Aligned_cols=65 Identities=32% Similarity=0.436 Sum_probs=42.3
Q ss_pred cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeeccCccccccCCccccCCCCCCCcccccc
Q 000153 8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH 87 (2021)
Q Consensus 8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh 87 (2021)
.||--|-||..|--.-.- .+- ..-..-+-||-.|.+ + ..---.|||-||||||-|-
T Consensus 15 ~K~talsin~~ykg~~~~-----------~aq------R~~vp~RhGmQslGK------a-~v~rrmpPPAnLPSLkaEn 70 (468)
T KOG4817|consen 15 PKFTALSINRMYKGSREP-----------SAQ------RNQVPRRHGMQSLGK------A-KVPRRMPPPANLPSLKAEN 70 (468)
T ss_pred cCcceeehhhhhcCCcCC-----------ccc------ccCCCccchhhhhcc------c-cccccCCCCCCCcchhhcc
Confidence 588888888888433100 000 122233678877764 1 2223579999999999999
Q ss_pred cccCCCCCC
Q 000153 88 ERFDSSGSN 96 (2021)
Q Consensus 88 ~~~d~~~~~ 96 (2021)
-+.|++-..
T Consensus 71 ~g~dpn~~l 79 (468)
T KOG4817|consen 71 HGSDPNNLL 79 (468)
T ss_pred cCCCCCcee
Confidence 999987543
No 30
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=94.71 E-value=0.7 Score=60.77 Aligned_cols=9 Identities=56% Similarity=0.693 Sum_probs=4.4
Q ss_pred cccccccCC
Q 000153 188 SLQAALPAA 196 (2021)
Q Consensus 188 sl~a~~p~~ 196 (2021)
.|+-+||+.
T Consensus 196 ~l~~~lp~~ 204 (697)
T PF09726_consen 196 LLQQALPPE 204 (697)
T ss_pred HHHHhCCCc
Confidence 345555544
No 31
>KOG3054 consensus Uncharacterized conserved protein [Function unknown]
Probab=94.52 E-value=0.3 Score=56.77 Aligned_cols=11 Identities=36% Similarity=0.296 Sum_probs=5.9
Q ss_pred CccccCCCCCC
Q 000153 758 SGFLDRGKPFN 768 (2021)
Q Consensus 758 SpfldR~K~~n 768 (2021)
..+-||+|++-
T Consensus 246 GVmDDRGKfIY 256 (299)
T KOG3054|consen 246 GVMDDRGKFIY 256 (299)
T ss_pred eeecCCCceEE
Confidence 34457766443
No 32
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=94.26 E-value=1.4 Score=54.91 Aligned_cols=8 Identities=38% Similarity=0.708 Sum_probs=4.7
Q ss_pred CCCCCCcc
Q 000153 537 FDGRDPFS 544 (2021)
Q Consensus 537 fDG~Dpf~ 544 (2021)
+.++||..
T Consensus 70 ~~gFDpea 77 (630)
T KOG0742|consen 70 WSGFDPEA 77 (630)
T ss_pred ccCCChHH
Confidence 45677653
No 33
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=94.15 E-value=0.88 Score=55.96 Aligned_cols=27 Identities=15% Similarity=0.361 Sum_probs=19.4
Q ss_pred CCCCcccccccccCCCCCcccccccccc
Q 000153 449 PWNNSVHSFNSQRAERNPWEQYGSEQYN 476 (2021)
Q Consensus 449 Pw~~~msSys~R~~eRt~dE~yg~~qy~ 476 (2021)
.|+...+.|..+..||... .|+..+-+
T Consensus 188 dwndvladyea~eswrent-a~gdi~ee 214 (672)
T KOG4722|consen 188 DWNDVLADYEAEESWRENT-AQGDIHEE 214 (672)
T ss_pred chhhHHHHHHHHHHHHhcc-hhhhhhcc
Confidence 4888899999999999333 56655433
No 34
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=93.92 E-value=0.88 Score=58.03 Aligned_cols=6 Identities=33% Similarity=0.130 Sum_probs=2.9
Q ss_pred Cccccc
Q 000153 780 SSTFIT 785 (2021)
Q Consensus 780 SSsF~P 785 (2021)
-|+|-|
T Consensus 249 ls~fdp 254 (514)
T TIGR03319 249 LSGFDP 254 (514)
T ss_pred ecCCch
Confidence 455544
No 35
>PRK00106 hypothetical protein; Provisional
Probab=93.84 E-value=0.82 Score=58.59 Aligned_cols=6 Identities=33% Similarity=0.130 Sum_probs=2.7
Q ss_pred Cccccc
Q 000153 780 SSTFIT 785 (2021)
Q Consensus 780 SSsF~P 785 (2021)
-|+|-|
T Consensus 270 lS~fdp 275 (535)
T PRK00106 270 LSGFDP 275 (535)
T ss_pred EeCCCh
Confidence 444543
No 36
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []. Ezrin was first identified as a constituent of microvilli [], radixin as a barbed, end-capping actin-modulating protein from isolated junctional fractions [], and moesin as a heparin binding protein []. A tumour suppressor molecule responsible for neurofibromatosis type 2 (NF2) is highly similar to ERM proteins and has been designated merlin (moesin-ezrin-radixin-like protein). ERM molecules contain 3 domains, an N-terminal globular domain; an extended alpha-helical domain; and a charged C-terminal domain []. Ezrin, radixin and merlin also contain a polyproline region between the helical and C-terminal domains. The N-terminal domain is highly conserved, and is also found in merlin, band 4.1 proteins and members of the band 4.1 superfamily. ERM proteins crosslink actin filaments with plasma membranes. They co-localise with CD44 at actin filament-plasma membrane interaction sites, associating with CD44 via their N-terminal domains and with actin filaments via their C-terminal domains [].; GO: 0008092 cytoskeletal protein binding, 0005737 cytoplasm, 0019898 extrinsic to membrane; PDB: 2I1J_A 2I1K_A 1E5W_A 1EF1_C.
Probab=93.63 E-value=3.4 Score=48.41 Aligned_cols=15 Identities=40% Similarity=0.492 Sum_probs=6.0
Q ss_pred HHHHHHHHHHHHHHH
Q 000153 574 ELERVQKMQEQERQR 588 (2021)
Q Consensus 574 ELERreKeqEEERKR 588 (2021)
+++++....+++.++
T Consensus 9 Ele~rL~q~eee~~~ 23 (246)
T PF00769_consen 9 ELEERLRQMEEEMRR 23 (246)
T ss_dssp HHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHH
Confidence 344443434444333
No 37
>PRK00106 hypothetical protein; Provisional
Probab=93.30 E-value=5.5 Score=51.44 Aligned_cols=7 Identities=43% Similarity=0.947 Sum_probs=2.9
Q ss_pred CCccccc
Q 000153 767 FNSWRRD 773 (2021)
Q Consensus 767 ~nswrR~ 773 (2021)
||-.||.
T Consensus 273 fdpvRRe 279 (535)
T PRK00106 273 FDPIRRE 279 (535)
T ss_pred CChHHHH
Confidence 3344444
No 38
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=93.15 E-value=2.2 Score=56.34 Aligned_cols=9 Identities=22% Similarity=0.187 Sum_probs=3.5
Q ss_pred ccccccccc
Q 000153 174 PAEKASVLR 182 (2021)
Q Consensus 174 ~~e~~~vlr 182 (2021)
-+|-++.||
T Consensus 132 ~~e~~~~~~ 140 (697)
T PF09726_consen 132 YVEASVRLK 140 (697)
T ss_pred HHHHHHhhc
Confidence 344333333
No 39
>PRK12705 hypothetical protein; Provisional
Probab=90.85 E-value=7.5 Score=50.00 Aligned_cols=13 Identities=38% Similarity=0.560 Sum_probs=6.9
Q ss_pred hhhhhhhhhhhcc
Q 000153 547 LVGVVKKKKDVLK 559 (2021)
Q Consensus 547 lisaIKKKKEelk 559 (2021)
++.++++++...+
T Consensus 21 ~~~~~~~~~~~~~ 33 (508)
T PRK12705 21 LVVLLKKRQRLAK 33 (508)
T ss_pred HHHHHHHHHHHHH
Confidence 4456666654433
No 40
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=89.24 E-value=15 Score=46.30 Aligned_cols=6 Identities=33% Similarity=0.440 Sum_probs=2.9
Q ss_pred cccCCC
Q 000153 787 DAENGH 792 (2021)
Q Consensus 787 d~ENg~ 792 (2021)
||.||.
T Consensus 358 dhG~gy 363 (420)
T COG4942 358 DHGGGY 363 (420)
T ss_pred EcCCcc
Confidence 444443
No 41
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=88.65 E-value=5.3 Score=48.71 Aligned_cols=42 Identities=21% Similarity=0.130 Sum_probs=23.4
Q ss_pred ccccccccccccccCCccccccCCCCCchhhhcccccccCccCCCcceeeccC
Q 000153 959 ISLAGLDRSEQHNLAQPEIIDVQPESTENEEQNLERSTTSRCDSQSSLSVSSA 1011 (2021)
Q Consensus 959 t~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~r~~t~~~~sqsslsvssp 1011 (2021)
..-++|.++||+...|.- ++ -.|++- ++.-.|-|+|.-.|+|
T Consensus 450 aSSp~~qssyqvginqrf-------ha--aRhkf~--aqad~dqqasgl~sp~ 491 (561)
T KOG1103|consen 450 ASSPAVQSSYQVGINQRF-------HA--ARHKFA--AQADMDQQASGLNSPA 491 (561)
T ss_pred cCChhhhhhhhhcchhhh-------hh--ccchhh--hcccCcccccccCCCc
Confidence 344678888887544422 11 123343 4666777777665544
No 42
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=88.62 E-value=2.4 Score=53.49 Aligned_cols=20 Identities=25% Similarity=0.275 Sum_probs=12.6
Q ss_pred hhhcccchhHhhhccccccc
Q 000153 201 KKQKDGFSQKQKQGMSQELG 220 (2021)
Q Consensus 201 ~k~~~~~~qk~k~~~~~~~~ 220 (2021)
+|.-+.+.-||+|.|+.--+
T Consensus 115 kkkmea~fakqrqklgksaf 134 (708)
T KOG3654|consen 115 KKKMEAIFAKQRQKLGKSAF 134 (708)
T ss_pred HHHHHHHHHHHHHHhchhhe
Confidence 34445566678877776555
No 43
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=87.21 E-value=12 Score=49.19 Aligned_cols=8 Identities=13% Similarity=0.401 Sum_probs=3.5
Q ss_pred CCCcCCcc
Q 000153 347 RDSETGKV 354 (2021)
Q Consensus 347 r~~e~~k~ 354 (2021)
|.|+.++|
T Consensus 575 ~~~~~~~~ 582 (1187)
T KOG0579|consen 575 RANAVSNI 582 (1187)
T ss_pred hhhhhhhh
Confidence 44444444
No 44
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=85.71 E-value=33 Score=45.36 Aligned_cols=11 Identities=36% Similarity=0.413 Sum_probs=5.0
Q ss_pred CCCCccccccc
Q 000153 183 GEDFPSLQAAL 193 (2021)
Q Consensus 183 gedfpsl~a~~ 193 (2021)
|+-|-++|++.
T Consensus 473 G~~~~s~qs~~ 483 (1187)
T KOG0579|consen 473 GSTFFSPQSSA 483 (1187)
T ss_pred CccccCccccC
Confidence 44444444444
No 45
>PF02029 Caldesmon: Caldesmon; InterPro: IPR006018 This group of proteins includes two protein families: caldesmon and lymphocyte specific protein. Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart).
Probab=85.37 E-value=3.2 Score=52.92 Aligned_cols=15 Identities=20% Similarity=0.339 Sum_probs=8.2
Q ss_pred cccCCCCCCCCCCCC
Q 000153 875 GWGQGRYRGNVHPPY 889 (2021)
Q Consensus 875 gW~~ssS~~rp~PP~ 889 (2021)
-|+...+.++..|.+
T Consensus 459 ~w~~~~~e~~~~~~~ 473 (492)
T PF02029_consen 459 QWLTKTPEGSKSPAP 473 (492)
T ss_pred HhhcCCCCCCCCCCC
Confidence 466666665554433
No 46
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins.
Probab=85.12 E-value=18 Score=50.81 Aligned_cols=7 Identities=43% Similarity=0.648 Sum_probs=2.8
Q ss_pred hhccccc
Q 000153 1228 LMDHLNA 1234 (2021)
Q Consensus 1228 ~~~~~~a 1234 (2021)
+++-|+.
T Consensus 1167 l~~~~~~ 1173 (1201)
T PF12128_consen 1167 LLDMCNS 1173 (1201)
T ss_pred HHHHHHh
Confidence 3333443
No 47
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=84.84 E-value=27 Score=47.19 Aligned_cols=11 Identities=27% Similarity=0.570 Sum_probs=6.2
Q ss_pred CCcccccCCCC
Q 000153 841 GQRWNMSGDGD 851 (2021)
Q Consensus 841 p~~W~apgDGd 851 (2021)
...|-+||-|.
T Consensus 734 ~~v~IIHGkGt 744 (782)
T PRK00409 734 GEVLIIHGKGT 744 (782)
T ss_pred CEEEEEcCCCh
Confidence 34555666664
No 48
>KOG3634 consensus Troponin [Cytoskeleton]
Probab=84.15 E-value=12 Score=45.89 Aligned_cols=9 Identities=33% Similarity=0.331 Sum_probs=4.2
Q ss_pred hhhhhhhhc
Q 000153 721 DGERMVERI 729 (2021)
Q Consensus 721 D~ERmVERI 729 (2021)
|+..+.+||
T Consensus 266 DlkeL~eRq 274 (361)
T KOG3634|consen 266 DLKELNERQ 274 (361)
T ss_pred cHHHHHHHH
Confidence 444445554
No 49
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=84.08 E-value=25 Score=47.41 Aligned_cols=13 Identities=23% Similarity=0.664 Sum_probs=7.0
Q ss_pred cCCCCCCeeecCC
Q 000153 277 YFPGPLPLVRLKP 289 (2021)
Q Consensus 277 ~~~gplplvrl~~ 289 (2021)
+|.-|..+|-||-
T Consensus 217 ~~~ep~~~~~ln~ 229 (771)
T TIGR01069 217 FYIEPQAIVKLNN 229 (771)
T ss_pred EEEEcHHHHHHHH
Confidence 4555555665553
No 50
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=83.74 E-value=24 Score=47.63 Aligned_cols=12 Identities=25% Similarity=0.515 Sum_probs=5.8
Q ss_pred cCCCCCCeeecC
Q 000153 277 YFPGPLPLVRLK 288 (2021)
Q Consensus 277 ~~~gplplvrl~ 288 (2021)
+|.-|..+|-||
T Consensus 222 ~y~ep~~~~~ln 233 (782)
T PRK00409 222 LYIEPQSVVELN 233 (782)
T ss_pred EEEEcHHHHHHH
Confidence 444455455444
No 51
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=83.00 E-value=81 Score=40.93 Aligned_cols=7 Identities=14% Similarity=0.245 Sum_probs=3.0
Q ss_pred cccCCCC
Q 000153 319 YWEGDFD 325 (2021)
Q Consensus 319 ~w~~~fd 325 (2021)
||++.|+
T Consensus 27 ~~n~~f~ 33 (582)
T PF09731_consen 27 KQNDNFR 33 (582)
T ss_pred hcChHHH
Confidence 4444443
No 52
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=82.35 E-value=31 Score=46.59 Aligned_cols=8 Identities=25% Similarity=0.439 Sum_probs=4.0
Q ss_pred cccccCCC
Q 000153 843 RWNMSGDG 850 (2021)
Q Consensus 843 ~W~apgDG 850 (2021)
.+=+||-|
T Consensus 725 v~IIHGkG 732 (771)
T TIGR01069 725 VLIIHGKG 732 (771)
T ss_pred EEEEcCCC
Confidence 34455555
No 53
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=82.16 E-value=54 Score=44.76 Aligned_cols=15 Identities=40% Similarity=0.724 Sum_probs=8.0
Q ss_pred ccccCC-CCCCCCCCCC
Q 000153 318 AYWEGD-FDMPRPSVLP 333 (2021)
Q Consensus 318 ~~w~~~-fd~~~~~~~p 333 (2021)
+-|+++ |.| +--|||
T Consensus 752 pvy~eepfvF-~KVvLp 767 (1189)
T KOG1265|consen 752 PVYEEEPFVF-RKVVLP 767 (1189)
T ss_pred cccccCCccc-ceeccc
Confidence 446554 444 444677
No 54
>PLN03086 PRLI-interacting factor K; Provisional
Probab=82.01 E-value=7.8 Score=50.41 Aligned_cols=10 Identities=0% Similarity=-0.409 Sum_probs=5.3
Q ss_pred CcccccCccc
Q 000153 816 GIMSSRNYYK 825 (2021)
Q Consensus 816 gFvsK~PY~~ 825 (2021)
.|+|-.|-..
T Consensus 185 t~vklqP~~~ 194 (567)
T PLN03086 185 TYAKLQPDGV 194 (567)
T ss_pred CEEEEeeccC
Confidence 4555555544
No 55
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=80.81 E-value=53 Score=48.43 Aligned_cols=12 Identities=42% Similarity=1.096 Sum_probs=7.1
Q ss_pred CCCCCCCCCCCC
Q 000153 498 RGFPHNDPMHNF 509 (2021)
Q Consensus 498 kG~~~ndP~~nF 509 (2021)
+|||.+=+...|
T Consensus 699 ~GfPnr~~~~eF 710 (1930)
T KOG0161|consen 699 QGFPNRMPFQEF 710 (1930)
T ss_pred hhCccccchHHH
Confidence 566666555555
No 56
>PTZ00491 major vault protein; Provisional
Probab=80.77 E-value=37 Score=46.20 Aligned_cols=10 Identities=30% Similarity=0.604 Sum_probs=5.7
Q ss_pred CCcccccCCC
Q 000153 150 DGVGVYVPPS 159 (2021)
Q Consensus 150 ~~~~~~~~~s 159 (2021)
++.|.|+|..
T Consensus 198 t~~gaylP~v 207 (850)
T PTZ00491 198 RTPGAYLPGV 207 (850)
T ss_pred eccccccCCC
Confidence 4466666654
No 57
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=80.60 E-value=59 Score=40.30 Aligned_cols=10 Identities=30% Similarity=0.584 Sum_probs=5.0
Q ss_pred CCCCCCCCCC
Q 000153 500 FPHNDPMHNF 509 (2021)
Q Consensus 500 ~~~ndP~~nF 509 (2021)
+++|||....
T Consensus 55 ~NinDP~~AL 64 (561)
T KOG1103|consen 55 LNINDPFAAL 64 (561)
T ss_pred cccCChHHHH
Confidence 4555555443
No 58
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=80.02 E-value=11 Score=47.85 Aligned_cols=17 Identities=24% Similarity=0.235 Sum_probs=9.7
Q ss_pred CCCCCCCcccccccccC
Q 000153 75 PPPLNLPSLRKEHERFD 91 (2021)
Q Consensus 75 p~plnlpslrkeh~~~d 91 (2021)
+.||---+-.++||--|
T Consensus 17 s~~l~ed~~~~~~ed~d 33 (708)
T KOG3654|consen 17 SKPLSEDPTKAPVEDPD 33 (708)
T ss_pred CcccccccccCCcCCCc
Confidence 44555445556676665
No 59
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=79.80 E-value=14 Score=44.31 Aligned_cols=6 Identities=33% Similarity=0.628 Sum_probs=2.3
Q ss_pred CCCCCC
Q 000153 803 GRAVPR 808 (2021)
Q Consensus 803 grsppr 808 (2021)
+++||+
T Consensus 254 ~t~fPR 259 (290)
T KOG2689|consen 254 HTGFPR 259 (290)
T ss_pred ecCCCc
Confidence 333444
No 60
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=79.59 E-value=4.4 Score=50.70 Aligned_cols=8 Identities=50% Similarity=0.567 Sum_probs=3.8
Q ss_pred ccccccCC
Q 000153 907 RSRYSMRH 914 (2021)
Q Consensus 907 r~rys~rq 914 (2021)
|+|--|+.
T Consensus 464 rsr~~~~R 471 (506)
T KOG2507|consen 464 RSRRRMPR 471 (506)
T ss_pred hhhhcCcC
Confidence 55554433
No 61
>PF06098 Radial_spoke_3: Radial spoke protein 3; InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=78.91 E-value=18 Score=43.95 Aligned_cols=15 Identities=13% Similarity=0.209 Sum_probs=10.5
Q ss_pred CCCcccccccCCCCC
Q 000153 335 KPAHNVFERWGQRDS 349 (2021)
Q Consensus 335 k~~~~~~~~~gqr~~ 349 (2021)
.|++-|||++=-|||
T Consensus 2 ~~~NiM~D~RV~RGn 16 (291)
T PF06098_consen 2 TYGNIMYDRRVVRGN 16 (291)
T ss_pred CcccccCCCCcCCCC
Confidence 467788887765555
No 62
>KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms]
Probab=77.11 E-value=1.5e+02 Score=34.67 Aligned_cols=11 Identities=27% Similarity=0.782 Sum_probs=5.3
Q ss_pred ccccccccccc
Q 000153 469 QYGSEQYNRFR 479 (2021)
Q Consensus 469 ~yg~~qy~rYr 479 (2021)
+|--.+|.+|+
T Consensus 71 ~y~r~~FgrYG 81 (225)
T KOG4848|consen 71 AYRRERFGRYG 81 (225)
T ss_pred HHHHHHHHhhc
Confidence 44444455554
No 63
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=76.49 E-value=62 Score=40.72 Aligned_cols=10 Identities=40% Similarity=0.461 Sum_probs=3.8
Q ss_pred hhhhhhcccc
Q 000153 723 ERMVERITTS 732 (2021)
Q Consensus 723 ERmVERI~TS 732 (2021)
|.---||..|
T Consensus 419 eefkrriles 428 (442)
T PF06637_consen 419 EEFKRRILES 428 (442)
T ss_pred HHHHHHHHhc
Confidence 3333344333
No 64
>PLN02316 synthase/transferase
Probab=76.44 E-value=30 Score=48.17 Aligned_cols=24 Identities=17% Similarity=0.267 Sum_probs=12.6
Q ss_pred CccccccccCCC--CcccccCcccCC
Q 000153 768 NSWRRDAFESGN--SSTFITQDAENG 791 (2021)
Q Consensus 768 nswrR~~~~rd~--SSsF~Pqd~ENg 791 (2021)
+.|-+-.|-|+. .+.|.|+.+.+.
T Consensus 509 ev~~~g~~NrWth~~~~~~~~~m~~~ 534 (1036)
T PLN02316 509 EVWFRGSFNRWTHRLGPLPPQKMVPA 534 (1036)
T ss_pred eEEEEccccCcCCCCCCCCceeeeec
Confidence 344444454444 345777766554
No 65
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=75.07 E-value=2.2e+02 Score=36.77 Aligned_cols=12 Identities=17% Similarity=0.318 Sum_probs=6.3
Q ss_pred hhhhhhhhhccc
Q 000153 549 GVVKKKKDVLKQ 560 (2021)
Q Consensus 549 saIKKKKEelkq 560 (2021)
.++++|..++..
T Consensus 225 ~flerkv~eled 236 (502)
T KOG0982|consen 225 RFLERKVQELED 236 (502)
T ss_pred HHHHHHHHHhhc
Confidence 445666555443
No 66
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=74.60 E-value=1.1e+02 Score=42.99 Aligned_cols=63 Identities=25% Similarity=0.293 Sum_probs=33.5
Q ss_pred cCCCCCCccCCCcccccccccCCCCccccccccCCCCchh--hhcccch---hHhhhcccccccccccCCCCCCC
Q 000153 162 SGTVGPALSSFAPAEKASVLRGEDFPSLQAALPAASGSEK--KQKDGFS---QKQKQGMSQELGNNEQKDGCRFN 231 (2021)
Q Consensus 162 ~~~~~~~~~~~~~~e~~~vlrgedfpsl~a~~p~~~~~~~--k~~~~~~---qk~k~~~~~~~~~~e~~~~~~~~ 231 (2021)
+|.++|-...|..+|+-+ --+|+.|-+++++.. ++-...- .||-|.+-+.|..-|.+-.+-.+
T Consensus 1193 tGv~gay~s~f~~me~kl-------~~ir~il~~~svs~~~i~~l~~~~~~lr~~l~~~~e~L~~~E~~Lsdi~~ 1260 (1758)
T KOG0994|consen 1193 TGVLGAYASRFLDMEEKL-------EEIRAILSAPSVSAEDIAQLASATESLRRQLQALTEDLPQEEETLSDITN 1260 (1758)
T ss_pred ccCchhhHhHHHHHHHHH-------HHHHHHhcCCCccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhh
Confidence 566666555555554322 124556655555554 2222222 37777777777766665554443
No 67
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=73.23 E-value=29 Score=41.96 Aligned_cols=12 Identities=8% Similarity=0.002 Sum_probs=5.4
Q ss_pred ccCCCCCccccc
Q 000153 810 EFYGGPGIMSSR 821 (2021)
Q Consensus 810 efyggagFvsK~ 821 (2021)
+|....+|+++-
T Consensus 250 P~~f~t~fPR~t 261 (290)
T KOG2689|consen 250 PYSFHTGFPRVT 261 (290)
T ss_pred CeeeecCCCcee
Confidence 344444444443
No 68
>KOG3634 consensus Troponin [Cytoskeleton]
Probab=73.20 E-value=26 Score=43.20 Aligned_cols=7 Identities=43% Similarity=0.610 Sum_probs=2.8
Q ss_pred HHHHHHH
Q 000153 679 IAKRQAE 685 (2021)
Q Consensus 679 eKKeEaE 685 (2021)
.-+++.+
T Consensus 204 mtKeQqE 210 (361)
T KOG3634|consen 204 MTKEQQE 210 (361)
T ss_pred ccHHHHH
Confidence 3344444
No 69
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=72.61 E-value=23 Score=45.99 Aligned_cols=6 Identities=33% Similarity=0.850 Sum_probs=2.8
Q ss_pred cccccc
Q 000153 469 QYGSEQ 474 (2021)
Q Consensus 469 ~yg~~q 474 (2021)
.||++.
T Consensus 149 ~yGIDs 154 (645)
T KOG0681|consen 149 AYGIDS 154 (645)
T ss_pred eechhh
Confidence 345544
No 70
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=71.45 E-value=1.7e+02 Score=40.41 Aligned_cols=10 Identities=20% Similarity=0.471 Sum_probs=4.4
Q ss_pred CCCCCCcccc
Q 000153 399 GDNRNGICER 408 (2021)
Q Consensus 399 gneR~GigvR 408 (2021)
.+++-.||+|
T Consensus 795 ~~GYrhv~LR 804 (1189)
T KOG1265|consen 795 NAGYRHVCLR 804 (1189)
T ss_pred cCcceeEEec
Confidence 3344444444
No 71
>PTZ00491 major vault protein; Provisional
Probab=71.14 E-value=93 Score=42.68 Aligned_cols=9 Identities=44% Similarity=0.936 Sum_probs=4.9
Q ss_pred CCcccccCC
Q 000153 150 DGVGVYVPP 158 (2021)
Q Consensus 150 ~~~~~~~~~ 158 (2021)
.++|.|.|-
T Consensus 145 ~gPGtYlPr 153 (850)
T PTZ00491 145 KGPGTYYPR 153 (850)
T ss_pred ECCeeecCC
Confidence 445566654
No 72
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=70.20 E-value=25 Score=45.02 Aligned_cols=11 Identities=27% Similarity=0.495 Sum_probs=5.8
Q ss_pred CCCcccccccC
Q 000153 291 SDWADDERDTG 301 (2021)
Q Consensus 291 sdwadderdt~ 301 (2021)
..|-+|..+-.
T Consensus 63 ~~~r~~~~~~~ 73 (460)
T KOG1363|consen 63 FNYRDDNVDVS 73 (460)
T ss_pred hcccccCCCcc
Confidence 55655555433
No 73
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=69.92 E-value=1.4e+02 Score=44.40 Aligned_cols=9 Identities=22% Similarity=0.298 Sum_probs=4.8
Q ss_pred CCccccccc
Q 000153 185 DFPSLQAAL 193 (2021)
Q Consensus 185 dfpsl~a~~ 193 (2021)
||.-|....
T Consensus 302 ~Y~f~~~~~ 310 (1930)
T KOG0161|consen 302 DYKFLSNGE 310 (1930)
T ss_pred hhhhhcccc
Confidence 555555544
No 74
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=69.57 E-value=87 Score=43.95 Aligned_cols=11 Identities=27% Similarity=0.344 Sum_probs=5.5
Q ss_pred CCceEEeeccC
Q 000153 52 GGGMLVLSRPR 62 (2021)
Q Consensus 52 ~ggm~vlsr~r 62 (2021)
+=||+++.+.|
T Consensus 645 ~c~~~~~~dd~ 655 (1758)
T KOG0994|consen 645 RCGMAIPKDDR 655 (1758)
T ss_pred ccccccccccc
Confidence 44555555443
No 75
>COG2433 Uncharacterized conserved protein [Function unknown]
Probab=69.53 E-value=1e+02 Score=40.93 Aligned_cols=12 Identities=8% Similarity=0.086 Sum_probs=6.2
Q ss_pred cccccccccCCC
Q 000153 453 SVHSFNSQRAER 464 (2021)
Q Consensus 453 ~msSys~R~~eR 464 (2021)
.++-++.++..+
T Consensus 266 vl~~~S~r~~~~ 277 (652)
T COG2433 266 VLDLESRRGIDR 277 (652)
T ss_pred EEeeeccccCCH
Confidence 444455555554
No 76
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=68.46 E-value=34 Score=42.92 Aligned_cols=49 Identities=22% Similarity=0.291 Sum_probs=27.0
Q ss_pred cccCCCCCCCCCCccCCCCcccccCCCCCccccCCCCCCccccccccCCC-Cccccc
Q 000153 730 TTSASSDSSGLHRSFDMSSRNQFARDNSSGFLDRGKPFNSWRRDAFESGN-SSTFIT 785 (2021)
Q Consensus 730 ~TSSSsDSs~~NR~~e~VaRI~TSRDidSpfldR~K~~nswrR~~~~rd~-SSsF~P 785 (2021)
+.+-+.++....|++ +-..+.+|.|.++ ..||..-.+-+.-.. ++.|-|
T Consensus 395 ~~~~~~e~qyDqRlF------nq~~g~dSg~~~d-d~ynvYD~~wr~~q~~~siYrp 444 (506)
T KOG2441|consen 395 KPSESGEVQYDQRLF------NQGKGLDSGFADD-DEYNVYDKPWRGAQDISSIYRP 444 (506)
T ss_pred CCCCCCcchhhHHhh------hcccCcccccccc-ccccccccccccCCchhhhhCC
Confidence 446667777777773 2335666777666 455554444333333 555544
No 77
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=67.65 E-value=2.6e+02 Score=36.16 Aligned_cols=15 Identities=20% Similarity=0.122 Sum_probs=7.3
Q ss_pred cCCCCCCCCCCCCCC
Q 000153 492 SFSSGGRGFPHNDPM 506 (2021)
Q Consensus 492 sfslGgkG~~~ndP~ 506 (2021)
.-+++.+.+..|.|.
T Consensus 170 ~ls~~~~a~~snspt 184 (502)
T KOG0982|consen 170 LLSVKKDAERSNSPT 184 (502)
T ss_pred hccccchhhccCchh
Confidence 344455555555444
No 78
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=66.62 E-value=2.8e+02 Score=35.75 Aligned_cols=21 Identities=19% Similarity=0.137 Sum_probs=11.0
Q ss_pred hhhhhhccccCCCCCCCCCCc
Q 000153 723 ERMVERITTSASSDSSGLHRS 743 (2021)
Q Consensus 723 ERmVERI~TSSSsDSs~~NR~ 743 (2021)
+-+|+.-..|......+-++.
T Consensus 156 d~~v~~~lpS~~~~~ld~h~g 176 (459)
T KOG0288|consen 156 DHFVEDTLPSRALFVLDAHEG 176 (459)
T ss_pred chhhhcccchhhhhhhhcccc
Confidence 445555455555555555544
No 79
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=66.56 E-value=1.4e+02 Score=38.23 Aligned_cols=7 Identities=43% Similarity=1.099 Sum_probs=3.1
Q ss_pred CCccccc
Q 000153 841 GQRWNMS 847 (2021)
Q Consensus 841 p~~W~ap 847 (2021)
..+|-.+
T Consensus 258 ~~rws~~ 264 (445)
T PRK13428 258 SQRWSAN 264 (445)
T ss_pred hCccCcc
Confidence 4444444
No 80
>KOG3756 consensus Pinin (desmosome-associated protein) [Cytoskeleton]
Probab=64.75 E-value=3.6e+02 Score=33.70 Aligned_cols=6 Identities=0% Similarity=-0.324 Sum_probs=2.3
Q ss_pred cccccc
Q 000153 381 MWRASS 386 (2021)
Q Consensus 381 ~Wr~ss 386 (2021)
+|+.+.
T Consensus 58 ~~~lr~ 63 (340)
T KOG3756|consen 58 SLLLRR 63 (340)
T ss_pred hhhhhh
Confidence 343333
No 81
>PRK04863 mukB cell division protein MukB; Provisional
Probab=64.04 E-value=2.6e+02 Score=41.03 Aligned_cols=11 Identities=9% Similarity=0.289 Sum_probs=6.1
Q ss_pred CCCCCCCCcee
Q 000153 1288 SLIPSPFPAIQ 1298 (2021)
Q Consensus 1288 slipspvpaiq 1298 (2021)
.+.|.|-|+|+
T Consensus 830 ~f~~~pe~~~~ 840 (1486)
T PRK04863 830 AFEADPEAELR 840 (1486)
T ss_pred hcCCCcHHHHH
Confidence 34556666654
No 82
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells [].
Probab=63.78 E-value=1.7e+02 Score=39.86 Aligned_cols=15 Identities=20% Similarity=0.441 Sum_probs=7.2
Q ss_pred CcccccccccCCCCC
Q 000153 81 PSLRKEHERFDSSGS 95 (2021)
Q Consensus 81 pslrkeh~~~d~~~~ 95 (2021)
|-+--.|-.+-+.|.
T Consensus 83 ~~f~v~~i~~n~~g~ 97 (717)
T PF10168_consen 83 PLFEVHQISLNPTGS 97 (717)
T ss_pred CceeEEEEEECCCCC
Confidence 445555555544443
No 83
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=62.97 E-value=3.6e+02 Score=38.10 Aligned_cols=18 Identities=22% Similarity=0.219 Sum_probs=8.1
Q ss_pred CCCCCCcccchhhhhhhh
Q 000153 537 FDGRDPFSAGLVGVVKKK 554 (2021)
Q Consensus 537 fDG~Dpf~~~lisaIKKK 554 (2021)
.+|..++...++..+.+-
T Consensus 662 TGGs~~~~a~~L~~l~~l 679 (1174)
T KOG0933|consen 662 TGGSRSKGADLLRQLQKL 679 (1174)
T ss_pred cCCCCCCcccHHHHHHHH
Confidence 444545544444444443
No 84
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=62.64 E-value=44 Score=43.64 Aligned_cols=6 Identities=33% Similarity=0.794 Sum_probs=3.1
Q ss_pred CCCeee
Q 000153 281 PLPLVR 286 (2021)
Q Consensus 281 plplvr 286 (2021)
+.|||-
T Consensus 23 ~~piVI 28 (645)
T KOG0681|consen 23 TIPIVI 28 (645)
T ss_pred CCcEEE
Confidence 455554
No 85
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]
Probab=62.52 E-value=1.4e+02 Score=40.54 Aligned_cols=15 Identities=33% Similarity=0.410 Sum_probs=9.3
Q ss_pred CCccccCCCCCCCccc
Q 000153 69 VPKLSVPPPLNLPSLR 84 (2021)
Q Consensus 69 ~~klsvp~plnlpslr 84 (2021)
--|-|--.|+| |-++
T Consensus 229 elkrSTel~in-PD~~ 243 (1424)
T KOG4572|consen 229 ELKRSTELPIN-PDEK 243 (1424)
T ss_pred hhccccccCCC-CCCc
Confidence 55666666777 5554
No 86
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=62.01 E-value=13 Score=50.23 Aligned_cols=25 Identities=44% Similarity=0.570 Sum_probs=12.0
Q ss_pred CCCCCCCC----CCCCCCCCCCceEEeec
Q 000153 36 HSGYYGSN----RARPTGGGGGGMLVLSR 60 (2021)
Q Consensus 36 ~~g~~~~~----~~~~~~~~~ggm~vlsr 60 (2021)
++|+||.+ ++++|.|.|||.-=.||
T Consensus 1204 gsGGYGgsa~~~~~~~Gagvg~GyrGvsr 1232 (1282)
T KOG0921|consen 1204 GSGGYGGSAPSARANYGAGVGNGYRGVSR 1232 (1282)
T ss_pred CCCCCCCCCCCCCCCccccccCCCccccC
Confidence 44555443 24445555666633333
No 87
>KOG2668 consensus Flotillins [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=61.59 E-value=3.4e+02 Score=34.47 Aligned_cols=8 Identities=13% Similarity=0.181 Sum_probs=2.9
Q ss_pred CCccCCCC
Q 000153 741 HRSFDMSS 748 (2021)
Q Consensus 741 NR~~e~Va 748 (2021)
++.+.+.+
T Consensus 398 ~~l~~~LP 405 (428)
T KOG2668|consen 398 AGLYKMLP 405 (428)
T ss_pred HHHHHhCc
Confidence 33333333
No 88
>PRK04863 mukB cell division protein MukB; Provisional
Probab=61.03 E-value=2.5e+02 Score=41.27 Aligned_cols=37 Identities=14% Similarity=0.395 Sum_probs=15.6
Q ss_pred ccC-CcccccCCCCccccccccCc-ccccccccccCCccc
Q 000153 839 SRG-QRWNMSGDGDHYGRNIEMES-DFHENITERYGDVGW 876 (2021)
Q Consensus 839 ~~p-~~W~apgDGd~igRq~E~dS-d~~~n~~erfGdsgW 876 (2021)
+|| ++.-+.+|-+-+.-. .|+. .|+.-+.-+|++.-|
T Consensus 730 ~~p~d~~li~~~~~~~~~~-~~~~~~~~~~v~~~~~~~~~ 768 (1486)
T PRK04863 730 DCPEDLYLIEGDPDSFDDS-VFSVEELEKAVVVKIADRQW 768 (1486)
T ss_pred CCccceeeecCChhHHhcc-CccHHHhcCCeeeeecchhh
Confidence 354 555554444433222 2222 222333445565555
No 89
>PRK12472 hypothetical protein; Provisional
Probab=60.80 E-value=1.1e+02 Score=39.89 Aligned_cols=8 Identities=13% Similarity=-0.192 Sum_probs=3.9
Q ss_pred CCccCCCC
Q 000153 515 PLLKREEP 522 (2021)
Q Consensus 515 s~~KsEKP 522 (2021)
+++|-.-|
T Consensus 136 SHGCVRLp 143 (508)
T PRK12472 136 SHGCVRMP 143 (508)
T ss_pred CCcccCCC
Confidence 55554443
No 90
>PF05914 RIB43A: RIB43A; InterPro: IPR008805 This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [].
Probab=60.75 E-value=4.5e+02 Score=33.45 Aligned_cols=14 Identities=14% Similarity=0.214 Sum_probs=5.7
Q ss_pred CCcccchhhhhhhh
Q 000153 541 DPFSAGLVGVVKKK 554 (2021)
Q Consensus 541 Dpf~~~lisaIKKK 554 (2021)
-.|.+..+....++
T Consensus 140 Q~F~GEDl~~~~R~ 153 (379)
T PF05914_consen 140 QKFDGEDLNREERK 153 (379)
T ss_pred cccccccCCHHHHH
Confidence 33444444443333
No 91
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells [].
Probab=60.40 E-value=3.9e+02 Score=36.55 Aligned_cols=9 Identities=33% Similarity=1.147 Sum_probs=4.1
Q ss_pred CCCCccccc
Q 000153 449 PWNNSVHSF 457 (2021)
Q Consensus 449 Pw~~~msSy 457 (2021)
+|...+..|
T Consensus 395 ~wl~~L~~f 403 (717)
T PF10168_consen 395 PWLSALQEF 403 (717)
T ss_pred ccHHHHHHH
Confidence 354444444
No 92
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=58.12 E-value=3.3e+02 Score=39.64 Aligned_cols=6 Identities=50% Similarity=1.049 Sum_probs=3.1
Q ss_pred ccCCCC
Q 000153 361 RVDPFG 366 (2021)
Q Consensus 361 ~~~~~~ 366 (2021)
.+|||+
T Consensus 57 rln~~~ 62 (1353)
T TIGR02680 57 RLEPDG 62 (1353)
T ss_pred ccCCCC
Confidence 445555
No 93
>PRK12472 hypothetical protein; Provisional
Probab=57.10 E-value=1.9e+02 Score=37.79 Aligned_cols=9 Identities=33% Similarity=0.704 Sum_probs=3.9
Q ss_pred cccccCCCC
Q 000153 908 SRYSMRHPR 916 (2021)
Q Consensus 908 ~rys~rqpr 916 (2021)
.||.-+||.
T Consensus 480 ~~~~~~~~~ 488 (508)
T PRK12472 480 QRYPKPQPA 488 (508)
T ss_pred ccCCCCCCC
Confidence 344444443
No 94
>COG2433 Uncharacterized conserved protein [Function unknown]
Probab=56.83 E-value=1.1e+02 Score=40.62 Aligned_cols=6 Identities=50% Similarity=0.983 Sum_probs=2.6
Q ss_pred cccCCC
Q 000153 308 DRDHGF 313 (2021)
Q Consensus 308 ~rd~g~ 313 (2021)
+|.|||
T Consensus 99 Arr~G~ 104 (652)
T COG2433 99 ARRHGI 104 (652)
T ss_pred HHHhCC
Confidence 344444
No 95
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=56.56 E-value=3.2e+02 Score=39.69 Aligned_cols=11 Identities=27% Similarity=0.265 Sum_probs=4.3
Q ss_pred CcccCCCCcee
Q 000153 1496 GLTSGSRGKRY 1506 (2021)
Q Consensus 1496 g~~sg~rg~~y 1506 (2021)
+..|||.-++-
T Consensus 1246 ~~lSgGek~~~ 1256 (1353)
T TIGR02680 1246 GPASGGERALA 1256 (1353)
T ss_pred cCCCchHHHHH
Confidence 33344444433
No 96
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=54.82 E-value=4.6e+02 Score=33.87 Aligned_cols=17 Identities=41% Similarity=0.499 Sum_probs=10.2
Q ss_pred ccccccCCCCchhhhcc
Q 000153 189 LQAALPAASGSEKKQKD 205 (2021)
Q Consensus 189 l~a~~p~~~~~~~k~~~ 205 (2021)
|||..|+--+++.|-|+
T Consensus 82 lqagtpplqVnEEk~~a 98 (672)
T KOG4722|consen 82 LQAGTPPLQVNEEKEKA 98 (672)
T ss_pred HhcCCCCCCCchhhccc
Confidence 56666666666655543
No 97
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=54.78 E-value=5e+02 Score=36.06 Aligned_cols=9 Identities=22% Similarity=0.530 Sum_probs=4.9
Q ss_pred CCcccccCc
Q 000153 779 NSSTFITQD 787 (2021)
Q Consensus 779 ~SSsF~Pqd 787 (2021)
+.-.|+|-+
T Consensus 573 gr~tflpl~ 581 (1164)
T TIGR02169 573 GRATFLPLN 581 (1164)
T ss_pred CCeeeccHh
Confidence 345566653
No 98
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function.
Probab=53.79 E-value=4.1e+02 Score=35.69 Aligned_cols=9 Identities=56% Similarity=0.962 Sum_probs=5.0
Q ss_pred ccccccccC
Q 000153 187 PSLQAALPA 195 (2021)
Q Consensus 187 psl~a~~p~ 195 (2021)
|++.+.||.
T Consensus 47 p~~~~~l~~ 55 (594)
T PF05667_consen 47 PSLGSSLPR 55 (594)
T ss_pred ccccCCCcc
Confidence 555555554
No 99
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=53.10 E-value=1.5e+02 Score=38.35 Aligned_cols=20 Identities=45% Similarity=0.689 Sum_probs=9.2
Q ss_pred CCCCCCCCCCCCCCCCCCce
Q 000153 36 HSGYYGSNRARPTGGGGGGM 55 (2021)
Q Consensus 36 ~~g~~~~~~~~~~~~~~ggm 55 (2021)
++|+.+...+++|+++||||
T Consensus 71 ~s~~g~~s~~~gg~~~~~g~ 90 (641)
T KOG3915|consen 71 GSGGGGGSSGNGGGGGGGGG 90 (641)
T ss_pred CCCCCccccCCCCCCCCCCC
Confidence 33443344444445555555
No 100
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=53.09 E-value=3.8e+02 Score=36.97 Aligned_cols=13 Identities=38% Similarity=0.580 Sum_probs=9.4
Q ss_pred CCCCCcccceeee
Q 000153 1534 PRRPRRQRTEFRV 1546 (2021)
Q Consensus 1534 ~r~~~~~rtefrv 1546 (2021)
+++.+--|||||-
T Consensus 1197 ~~tvlaeRt~l~c 1209 (1265)
T KOG0976|consen 1197 PHTVLAERTELRC 1209 (1265)
T ss_pred chhhhhhhhheee
Confidence 3456778999984
No 101
>PF06936 Selenoprotein_S: Selenoprotein S (SelS); InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. These proteins are involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins which participate in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner []. They probably serve as a linker between DER1, which mediates the retro-translocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.; GO: 0008430 selenium binding, 0006886 intracellular protein transport, 0030176 integral to endoplasmic reticulum membrane; PDB: 2Q2F_A.
Probab=52.98 E-value=77 Score=36.68 Aligned_cols=6 Identities=0% Similarity=0.063 Sum_probs=0.0
Q ss_pred CCCccc
Q 000153 524 QDDPFM 529 (2021)
Q Consensus 524 sEDpfM 529 (2021)
.|...+
T Consensus 17 ~~~~~~ 22 (190)
T PF06936_consen 17 LENEDL 22 (190)
T ss_dssp ------
T ss_pred CcchhH
Confidence 333333
No 102
>PRK03918 chromosome segregation protein; Provisional
Probab=52.10 E-value=7e+02 Score=34.05 Aligned_cols=12 Identities=33% Similarity=0.340 Sum_probs=7.5
Q ss_pred CCCcCCcccccc
Q 000153 347 RDSETGKVSSSE 358 (2021)
Q Consensus 347 r~~e~~k~~~se 358 (2021)
+.|-+||.+.-+
T Consensus 30 G~nG~GKStil~ 41 (880)
T PRK03918 30 GQNGSGKSSILE 41 (880)
T ss_pred cCCCCCHHHHHH
Confidence 346688876544
No 103
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=51.62 E-value=6.7e+02 Score=32.62 Aligned_cols=15 Identities=27% Similarity=0.250 Sum_probs=7.6
Q ss_pred cCccCCCcceeeccC
Q 000153 997 TSRCDSQSSLSVSSA 1011 (2021)
Q Consensus 997 t~~~~sqsslsvssp 1011 (2021)
.-+|.|=.+-.|=||
T Consensus 383 g~k~asDwtrvvfSp 397 (459)
T KOG0288|consen 383 GFKCASDWTRVVFSP 397 (459)
T ss_pred ccccccccceeEECC
Confidence 344555555555555
No 104
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=50.98 E-value=6.1e+02 Score=35.24 Aligned_cols=6 Identities=33% Similarity=0.578 Sum_probs=2.3
Q ss_pred cCCccc
Q 000153 350 ETGKVS 355 (2021)
Q Consensus 350 e~~k~~ 355 (2021)
-.||..
T Consensus 33 GsGKS~ 38 (1164)
T TIGR02169 33 GSGKSN 38 (1164)
T ss_pred CCCHHH
Confidence 334433
No 105
>KOG2894 consensus Uncharacterized conserved protein XAP-5 [Function unknown]
Probab=50.25 E-value=1.7e+02 Score=35.78 Aligned_cols=10 Identities=40% Similarity=0.411 Sum_probs=4.4
Q ss_pred ccccCCCCCC
Q 000153 729 ITTSASSDSS 738 (2021)
Q Consensus 729 I~TSSSsDSs 738 (2021)
|.|++.+.+.
T Consensus 256 IvtkArGKsG 265 (331)
T KOG2894|consen 256 IVTKARGKSG 265 (331)
T ss_pred HHHHhccCCC
Confidence 4444444443
No 106
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=48.85 E-value=3.5e+02 Score=38.88 Aligned_cols=27 Identities=19% Similarity=0.267 Sum_probs=14.6
Q ss_pred cCcccccccccCCCCCCCCCCCCCCCC
Q 000153 424 SSPFRDTVQDDSGRRDIDYGPGGRQPW 450 (2021)
Q Consensus 424 ~sp~r~~~~dd~grRD~GyGrng~qPw 450 (2021)
++-++++.+-.-+.|+.-.||||-..+
T Consensus 309 SeeakdLI~~ll~~~e~RLgrngiedi 335 (1317)
T KOG0612|consen 309 SEEAKDLIEALLCDREVRLGRNGIEDI 335 (1317)
T ss_pred CHHHHHHHHHHhcChhhhcccccHHHH
Confidence 333444444445566666677775543
No 107
>PF15359 CDV3: Carnitine deficiency-associated protein 3
Probab=48.68 E-value=44 Score=36.59 Aligned_cols=63 Identities=29% Similarity=0.421 Sum_probs=33.9
Q ss_pred CCCCCCCccccccccccCcccCCCCccCCCCCCCCCcccccCCCCCcCC-CCCCccCCCccccccccc-CCCCccccccc
Q 000153 116 TGWTKPGTAVGSDQKINDKVDQGPHSVDGLSKGNDGVGVYVPPSVRSGT-VGPALSSFAPAEKASVLR-GEDFPSLQAAL 193 (2021)
Q Consensus 116 ~gw~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~-~~~~~~~~~~~e~~~vlr-gedfpsl~a~~ 193 (2021)
.=|.|++++.......- +... --...++|||.||.+|-.. .-....+ |==|- =+-||||+||.
T Consensus 59 GPWnk~~~~~~~~~~~~--v~~~-------~~p~~~~gvY~PP~~R~~~~~r~~~qg------aPdI~Se~~FPSL~sta 123 (129)
T PF15359_consen 59 GPWNKSAPAQAPPAPAP--VEEP-------PEPATTSGVYRPPAARNTTTKRKRPQG------APDIFSEEQFPSLQSTA 123 (129)
T ss_pred CCCcCCCCCCCCCCCCc--cCCC-------CCCCCCCceecCcccccccccCCCCCC------CCCccccccccchHHHh
Confidence 36999887544444432 1111 1135688999999999322 1111111 01111 24799999874
No 108
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=46.83 E-value=2.2e+02 Score=34.87 Aligned_cols=13 Identities=15% Similarity=0.325 Sum_probs=6.3
Q ss_pred hhhhhccccCCCC
Q 000153 724 RMVERITTSASSD 736 (2021)
Q Consensus 724 RmVERI~TSSSsD 736 (2021)
.+...|+..+.+-
T Consensus 341 ~~a~~i~a~aaga 353 (379)
T COG5269 341 QLAADIKAEAAGA 353 (379)
T ss_pred HHHHHhhhhhccH
Confidence 3445555554443
No 109
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=46.02 E-value=7.6e+02 Score=35.86 Aligned_cols=15 Identities=33% Similarity=0.596 Sum_probs=7.1
Q ss_pred cccc-CCCCCCceeec
Q 000153 1315 LAHM-HPSQPPVFQFG 1329 (2021)
Q Consensus 1315 l~~m-h~s~~plfqfg 1329 (2021)
|-|+ |++.+=|++|+
T Consensus 1205 ~v~~~~~~~~~l~~~~ 1220 (1317)
T KOG0612|consen 1205 LVHKGHEFIPFLYHFP 1220 (1317)
T ss_pred hcCCCCcchHHHhhcc
Confidence 3344 45555454443
No 110
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]
Probab=45.93 E-value=7.7e+02 Score=32.08 Aligned_cols=28 Identities=18% Similarity=0.165 Sum_probs=14.5
Q ss_pred ccccccCCccccCCCCCCCCCCCCCCCC
Q 000153 866 NITERYGDVGWGQGRYRGNVHPPYPDRI 893 (2021)
Q Consensus 866 n~~erfGdsgW~~ssS~~rp~PP~peR~ 893 (2021)
|+..-||..=.+...+++..+|.+.--|
T Consensus 473 ~~~g~~g~~llA~r~sH~s~~~t~~~~m 500 (552)
T KOG2129|consen 473 NSIGEPGHRLLAERRSHGSSPPTVVVQM 500 (552)
T ss_pred cccCCCchhHHHHHHhcCCCCcchhhhh
Confidence 3334445444555666666665554444
No 111
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]
Probab=45.63 E-value=7.5e+02 Score=34.78 Aligned_cols=8 Identities=25% Similarity=0.268 Sum_probs=3.1
Q ss_pred CcccccCC
Q 000153 526 DPFMKDFG 533 (2021)
Q Consensus 526 DpfMeDFG 533 (2021)
+.|..++.
T Consensus 312 ~~~~~~~~ 319 (980)
T KOG0980|consen 312 DLFEAEPA 319 (980)
T ss_pred cccccCcc
Confidence 33333343
No 112
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=44.41 E-value=37 Score=42.07 Aligned_cols=29 Identities=38% Similarity=0.804 Sum_probs=22.6
Q ss_pred ccccCCCCCCCcccccccccCCCCCCCCC
Q 000153 71 KLSVPPPLNLPSLRKEHERFDSSGSNGGP 99 (2021)
Q Consensus 71 klsvp~plnlpslrkeh~~~d~~~~~~~~ 99 (2021)
.-.||||-..||.++...-||.-|.-||.
T Consensus 310 nE~~ppppempswqqqq~~~~~~ggrggg 338 (465)
T KOG3973|consen 310 NEMVPPPPEMPSWQQQQHTFDRQGGRGGG 338 (465)
T ss_pred ccCCCCCCCCCcHHHhcCCCCCCCCcCCC
Confidence 34589999999999998888887654433
No 113
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=44.27 E-value=46 Score=41.89 Aligned_cols=9 Identities=22% Similarity=-0.027 Sum_probs=3.9
Q ss_pred cCCCCCCCC
Q 000153 732 SASSDSSGL 740 (2021)
Q Consensus 732 SSSsDSs~~ 740 (2021)
..-+++.+.
T Consensus 412 ~~g~dSg~~ 420 (506)
T KOG2441|consen 412 GKGLDSGFA 420 (506)
T ss_pred ccCcccccc
Confidence 344444433
No 114
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=43.95 E-value=1.1e+03 Score=34.14 Aligned_cols=18 Identities=11% Similarity=0.307 Sum_probs=6.8
Q ss_pred ccCcccccccccccCCcc
Q 000153 858 EMESDFHENITERYGDVG 875 (2021)
Q Consensus 858 E~dSd~~~n~~erfGdsg 875 (2021)
.||+.|..-|.-.||++.
T Consensus 600 ~~d~~~~~~~~~~l~~t~ 617 (1163)
T COG1196 600 DFDPKYEPAVRFVLGDTL 617 (1163)
T ss_pred cCCHHHHHHHHHHhCCeE
Confidence 344433333333444433
No 115
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=43.81 E-value=8.7e+02 Score=35.21 Aligned_cols=7 Identities=43% Similarity=0.790 Sum_probs=2.8
Q ss_pred hhccccc
Q 000153 1228 LMDHLNA 1234 (2021)
Q Consensus 1228 ~~~~~~a 1234 (2021)
++||+|.
T Consensus 1168 lVDslDP 1174 (1293)
T KOG0996|consen 1168 LVDSLDP 1174 (1293)
T ss_pred eeccCCC
Confidence 3444443
No 116
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=42.07 E-value=1.7e+02 Score=37.76 Aligned_cols=8 Identities=50% Similarity=0.580 Sum_probs=3.3
Q ss_pred ccccccCC
Q 000153 177 KASVLRGE 184 (2021)
Q Consensus 177 ~~~vlrge 184 (2021)
|-|-|||-
T Consensus 178 KmVd~rG~ 185 (641)
T KOG3915|consen 178 KMVDLRGA 185 (641)
T ss_pred eeeeecCc
Confidence 33444443
No 117
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=40.66 E-value=1.2e+03 Score=32.70 Aligned_cols=23 Identities=30% Similarity=0.592 Sum_probs=13.1
Q ss_pred cCCCCccceEEEeecccCCCCCCCCCCc
Q 000153 1269 GLSQAETPVKLQFGLFSGPSLIPSPFPA 1296 (2021)
Q Consensus 1269 ~~~~~e~pv~lqfglfsgpslipspvpa 1296 (2021)
.+.|++-|.++ -||.-|-|--|-
T Consensus 971 sisqprNpsri-----agp~svtslE~m 993 (1265)
T KOG0976|consen 971 SISQPRNPSRI-----AGPKSVTSLEPM 993 (1265)
T ss_pred EeecCCCchhh-----cCcccccccccc
Confidence 35566666653 466666655553
No 118
>PLN03188 kinesin-12 family protein; Provisional
Probab=40.47 E-value=1.4e+03 Score=33.74 Aligned_cols=23 Identities=26% Similarity=0.286 Sum_probs=13.7
Q ss_pred ccCCccccccccccccccCcccc
Q 000153 407 ERPSSLNREANKETKFMSSPFRD 429 (2021)
Q Consensus 407 vRp~S~~R~~tKe~kY~~sp~r~ 429 (2021)
+.|+++.=.+...+....+|..+
T Consensus 671 ~~~~~lsi~p~~~~~~l~~p~~s 693 (1320)
T PLN03188 671 ASPSSLSIVPVEVSPVLKSPTLS 693 (1320)
T ss_pred CCccccccccccccccccCCccc
Confidence 56666666666666666666433
No 119
>PF12004 DUF3498: Domain of unknown function (DUF3498); InterPro: IPR021887 This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 433 to 538 amino acids in length. This domain is found associated with PF00616 from PFAM, PF00168 from PFAM. This domain has two conserved sequence motifs: DLQ and PLSFQNP. ; PDB: 3BXJ_B.
Probab=38.54 E-value=10 Score=48.66 Aligned_cols=8 Identities=25% Similarity=-0.055 Sum_probs=0.0
Q ss_pred CCcccccc
Q 000153 379 GNMWRASS 386 (2021)
Q Consensus 379 ~n~Wr~ss 386 (2021)
+..||.++
T Consensus 236 ~~s~rqlS 243 (495)
T PF12004_consen 236 DFSRRQLS 243 (495)
T ss_dssp --------
T ss_pred chhhhhcc
Confidence 34444444
No 120
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=37.91 E-value=5.5e+02 Score=36.09 Aligned_cols=15 Identities=20% Similarity=0.257 Sum_probs=11.0
Q ss_pred eccceeccccccCCC
Q 000153 1328 FGQLRYTSPVSQGVL 1342 (2021)
Q Consensus 1328 fgqlry~~pi~q~v~ 1342 (2021)
|-|+|.-+-+.||-+
T Consensus 1108 ~~qer~er~~Lkg~~ 1122 (1243)
T KOG0971|consen 1108 ISQERHERSILKGAQ 1122 (1243)
T ss_pred HHHHHHHHHHHhHHH
Confidence 567888877888754
No 121
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=35.50 E-value=26 Score=43.30 Aligned_cols=20 Identities=45% Similarity=0.790 Sum_probs=9.2
Q ss_pred CCCCCCCCCCCCCCCCCCce
Q 000153 36 HSGYYGSNRARPTGGGGGGM 55 (2021)
Q Consensus 36 ~~g~~~~~~~~~~~~~~ggm 55 (2021)
+||+.|..+|.+||||+||+
T Consensus 441 gggr~gggrgrgggggrg~y 460 (465)
T KOG3973|consen 441 GGGRDGGGRGRGGGGGRGGY 460 (465)
T ss_pred CCCCCCCCCCCCCCCCCccc
Confidence 44444444444444555553
No 122
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=34.74 E-value=6e+02 Score=34.99 Aligned_cols=12 Identities=25% Similarity=0.288 Sum_probs=9.6
Q ss_pred cCCCCCCCCCcc
Q 000153 912 MRHPRVLPPPTL 923 (2021)
Q Consensus 912 ~rqprvlppp~~ 923 (2021)
||++-|.++|.-
T Consensus 440 ~~~~~~~~~p~~ 451 (916)
T KOG0249|consen 440 MDRMGVMTLPSD 451 (916)
T ss_pred ccCCccccCccc
Confidence 688999998844
No 123
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]
Probab=34.70 E-value=1.4e+03 Score=33.11 Aligned_cols=31 Identities=26% Similarity=0.188 Sum_probs=17.6
Q ss_pred CCCCCCCCCCCCCCccccccc---cccccCCCCCC
Q 000153 887 PPYPDRIYPNPETDVISSFGR---SRYSMRHPRVL 918 (2021)
Q Consensus 887 PP~peR~Yqnsd~d~~~s~~r---~rys~rqprvl 918 (2021)
||+--..--+.|++.+| |+. -+||+|++|..
T Consensus 617 ~p~n~~~aytldg~~~~-~~g~~~~~ySt~~~~~r 650 (1074)
T KOG0250|consen 617 PPANVTKAYTLDGRQIF-AGGPNYRVYSTRGTRAR 650 (1074)
T ss_pred CCccceeeeccCccccc-cCCCCcceeccCCCCCC
Confidence 44444442244555553 333 48999998765
No 124
>COG4499 Predicted membrane protein [Function unknown]
Probab=34.64 E-value=90 Score=39.53 Aligned_cols=21 Identities=24% Similarity=0.327 Sum_probs=8.9
Q ss_pred hhhhhhhhhhcccccccchhh
Q 000153 548 VGVVKKKKDVLKQTDFHDPVR 568 (2021)
Q Consensus 548 isaIKKKKEelkq~e~EeKrR 568 (2021)
.+++|+..+..-...+-...+
T Consensus 347 ~Al~k~~eevksn~~lsg~~r 367 (434)
T COG4499 347 LALTKLYEEVKSNTDLSGDKR 367 (434)
T ss_pred HHHHHHHHHHhcccCCCchHH
Confidence 344444444433344444433
No 125
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=32.52 E-value=1.8e+03 Score=32.02 Aligned_cols=8 Identities=25% Similarity=0.505 Sum_probs=4.0
Q ss_pred CCcccccC
Q 000153 779 NSSTFITQ 786 (2021)
Q Consensus 779 ~SSsF~Pq 786 (2021)
+.-+|+|-
T Consensus 567 gr~tflpl 574 (1163)
T COG1196 567 GRATFLPL 574 (1163)
T ss_pred CccccCch
Confidence 34555553
No 126
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=31.74 E-value=1.6e+03 Score=31.36 Aligned_cols=11 Identities=27% Similarity=0.323 Sum_probs=6.0
Q ss_pred CcCCccccccc
Q 000153 349 SETGKVSSSEV 359 (2021)
Q Consensus 349 ~e~~k~~~se~ 359 (2021)
|=+||.+.=+-
T Consensus 34 nGsGKSSIldA 44 (908)
T COG0419 34 NGAGKSSILDA 44 (908)
T ss_pred CCCcHHHHHHH
Confidence 45666664443
No 127
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=29.87 E-value=2.1e+02 Score=37.46 Aligned_cols=15 Identities=40% Similarity=0.523 Sum_probs=8.9
Q ss_pred CcCCCCCCccccccc
Q 000153 373 SREGREGNMWRASSS 387 (2021)
Q Consensus 373 ~r~g~e~n~Wr~ssp 387 (2021)
.|.|++||+-.+.-|
T Consensus 349 aR~gr~G~Aivfl~p 363 (567)
T KOG0345|consen 349 ARAGREGNAIVFLNP 363 (567)
T ss_pred hhccCccceEEEecc
Confidence 355666666666554
No 128
>KOG2505 consensus Ankyrin repeat protein [General function prediction only]
Probab=29.58 E-value=2.2e+02 Score=37.42 Aligned_cols=8 Identities=25% Similarity=-0.147 Sum_probs=3.4
Q ss_pred hccccccc
Q 000153 213 QGMSQELG 220 (2021)
Q Consensus 213 ~~~~~~~~ 220 (2021)
-.|+++-+
T Consensus 103 ~ils~edF 110 (591)
T KOG2505|consen 103 PILSEEDF 110 (591)
T ss_pred CcccHHHH
Confidence 34444433
No 129
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=29.11 E-value=9.5e+02 Score=31.63 Aligned_cols=113 Identities=18% Similarity=0.208 Sum_probs=0.0
Q ss_pred HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHH
Q 000153 595 RALELARREEEERLRVAR-EQEEQRRRLEEETREAVW-RAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAAKQKL 672 (2021)
Q Consensus 595 RreEEeRKEEEERERkeR-EEEERrRReEEErRErEE-rEEeEReEaERREEEERrReEEEKRRreEEEERRKEEEEeKR 672 (2021)
+.+-..+--++.-.+..+ +.+..+...++...+... +.+..-.+++++.-|.++.+...+.++-.+|.+..+|+.+..
T Consensus 329 qleSqr~y~e~~~~e~~qsqlen~k~~~e~~~~e~~~l~~~~~~~e~~kk~~e~k~~q~q~k~~k~~kel~~~~E~n~~l 408 (493)
T KOG0804|consen 329 QLESQRKYYEQIMSEYEQSQLENQKQYYELLITEADSLKQESSDLEAEKKIVERKLQQLQTKLKKCQKELKEEREENKKL 408 (493)
T ss_pred hhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_pred HHHHHHHHHHHHHHHHHhhhcchhhhhhccccccc
Q 000153 673 LELEERIAKRQAEAAKSDSNSSDIADEKSSGLAKE 707 (2021)
Q Consensus 673 kEeEEreKKeEaEaEKrereAeakaeEKaraivkE 707 (2021)
.+...--...-.+.+++.+++....+++...+.++
T Consensus 409 ~knq~vw~~kl~~~~e~~~~~~~s~d~~I~dLqEQ 443 (493)
T KOG0804|consen 409 IKNQDVWRGKLKELEEREKEALGSKDEKITDLQEQ 443 (493)
T ss_pred HhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
No 130
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=28.74 E-value=7.2e+02 Score=30.85 Aligned_cols=12 Identities=42% Similarity=0.683 Sum_probs=5.8
Q ss_pred hhcccccCCCCC
Q 000153 271 VRKQEEYFPGPL 282 (2021)
Q Consensus 271 ~rk~~~~~~gpl 282 (2021)
+|-..+||-|-+
T Consensus 16 ~~~~~~~f~~~~ 27 (379)
T COG5269 16 ARIHSEYFKGRN 27 (379)
T ss_pred cChHHHHhcchh
Confidence 344445555543
No 131
>PF00901 Orbi_VP5: Orbivirus outer capsid protein VP5; InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid. Cryoelectron microscopy indicates that VP5 is a trimer suggesting that there are 360 copies of VP5 per virion [].; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=28.57 E-value=1.6e+03 Score=30.11 Aligned_cols=10 Identities=20% Similarity=0.395 Sum_probs=4.3
Q ss_pred hhhhhhhccc
Q 000153 551 VKKKKDVLKQ 560 (2021)
Q Consensus 551 IKKKKEelkq 560 (2021)
+..|-.+++.
T Consensus 89 l~~Kl~eLE~ 98 (508)
T PF00901_consen 89 LQRKLKELED 98 (508)
T ss_pred HHHHHHHHHH
Confidence 3444444443
No 132
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=28.05 E-value=1.5e+02 Score=42.84 Aligned_cols=12 Identities=17% Similarity=0.390 Sum_probs=6.8
Q ss_pred CCCCCccccccc
Q 000153 376 GREGNMWRASSS 387 (2021)
Q Consensus 376 g~e~n~Wr~ssp 387 (2021)
+-+-.+|.++..
T Consensus 1924 ~~~p~s~~a~~~ 1935 (2220)
T KOG3598|consen 1924 AAAPTSWNAPIA 1935 (2220)
T ss_pred hcCCccccccch
Confidence 445566766543
No 133
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=27.99 E-value=1.2e+03 Score=31.95 Aligned_cols=14 Identities=21% Similarity=0.074 Sum_probs=6.4
Q ss_pred CCCCcchhHhhhcc
Q 000153 261 DTGSARRSEQVRKQ 274 (2021)
Q Consensus 261 ~~g~~~~~e~~rk~ 274 (2021)
.+|-.|.-=-.||+
T Consensus 210 SLGITCIELAERkP 223 (948)
T KOG0577|consen 210 SLGITCIELAERKP 223 (948)
T ss_pred eccchhhhhhhcCC
Confidence 34444544344554
No 134
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=26.80 E-value=1.6e+02 Score=42.46 Aligned_cols=6 Identities=33% Similarity=0.916 Sum_probs=2.9
Q ss_pred ccccCC
Q 000153 153 GVYVPP 158 (2021)
Q Consensus 153 ~~~~~~ 158 (2021)
..|+-|
T Consensus 1772 ~yyL~P 1777 (2220)
T KOG3598|consen 1772 DYYLAP 1777 (2220)
T ss_pred hhhccC
Confidence 345544
No 135
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics]
Probab=25.44 E-value=1.9e+02 Score=35.85 Aligned_cols=12 Identities=25% Similarity=0.207 Sum_probs=6.3
Q ss_pred CCCCCeeecCCC
Q 000153 279 PGPLPLVRLKPR 290 (2021)
Q Consensus 279 ~gplplvrl~~~ 290 (2021)
-|+-|+.+|++-
T Consensus 25 ~g~~~~~h~~y~ 36 (410)
T KOG4715|consen 25 GGYNPYTHLAYS 36 (410)
T ss_pred CCCCcchhhhcc
Confidence 444555566543
No 136
>PLN03188 kinesin-12 family protein; Provisional
Probab=25.32 E-value=2.2e+03 Score=31.93 Aligned_cols=12 Identities=42% Similarity=0.634 Sum_probs=5.7
Q ss_pred CccccCCCCCCC
Q 000153 70 PKLSVPPPLNLP 81 (2021)
Q Consensus 70 ~klsvp~plnlp 81 (2021)
+||-.|-|.+.|
T Consensus 65 ~~~~sp~p~~pp 76 (1320)
T PLN03188 65 AKLKSPLPPRPP 76 (1320)
T ss_pred ccccCCCCCCCC
Confidence 444444455544
No 137
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=24.44 E-value=1.6e+03 Score=31.31 Aligned_cols=21 Identities=14% Similarity=0.188 Sum_probs=11.9
Q ss_pred hhcccCCCCCCcccCCCCcee
Q 000153 1486 EKSLTGSKAQGLTSGSRGKRY 1506 (2021)
Q Consensus 1486 ~k~~~~~k~~g~~sg~rg~~y 1506 (2021)
.+-|-..++-++|+-|+-||+
T Consensus 816 aRq~Le~eF~nLi~~gtdrr~ 836 (916)
T KOG0249|consen 816 ARQLLEREFNNLLALGTDRRL 836 (916)
T ss_pred HHHHHHHHHHhhhcccccccC
Confidence 344455566666666655554
No 138
>KOG3878 consensus Protein involved in maintenance of Golgi structure and ER-Golgi transport [Intracellular trafficking, secretion, and vesicular transport]
Probab=24.29 E-value=1.5e+03 Score=28.88 Aligned_cols=7 Identities=29% Similarity=0.800 Sum_probs=3.5
Q ss_pred Ccccccc
Q 000153 768 NSWRRDA 774 (2021)
Q Consensus 768 nswrR~~ 774 (2021)
.+|-|+.
T Consensus 301 s~WtRpd 307 (469)
T KOG3878|consen 301 SIWTRPD 307 (469)
T ss_pred hhcCccc
Confidence 3455553
No 139
>PF03154 Atrophin-1: Atrophin-1 family; InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA (OMIM:125370) is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins [, ]. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity [].. This entry includes Atrophin-1 and related proteins.
Probab=23.79 E-value=43 Score=45.99 Aligned_cols=8 Identities=13% Similarity=0.031 Sum_probs=4.0
Q ss_pred CCCccccC
Q 000153 756 NSSGFLDR 763 (2021)
Q Consensus 756 idSpfldR 763 (2021)
-|.+.|..
T Consensus 667 pDTPALRt 674 (982)
T PF03154_consen 667 PDTPALRT 674 (982)
T ss_pred CCcHHHHH
Confidence 45555533
No 140
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=22.86 E-value=2.4e+03 Score=30.47 Aligned_cols=32 Identities=28% Similarity=0.444 Sum_probs=19.3
Q ss_pred cccCCCCCCcccccCCCCCCCCCCCCCCCCcccccccCC-CCCcC
Q 000153 308 DRDHGFSKSEAYWEGDFDMPRPSVLPHKPAHNVFERWGQ-RDSET 351 (2021)
Q Consensus 308 ~rd~g~sk~e~~w~~~fd~~~~~~~p~k~~~~~~~~~gq-r~~e~ 351 (2021)
|+..|--+.--|++- ..+|.||-|.-| |--|.
T Consensus 46 GKNnGsVqg~qYF~C------------d~ncG~FVr~sq~r~lEd 78 (1243)
T KOG0971|consen 46 GKNNGSVQGVQYFEC------------DENCGVFVRSSQVRELED 78 (1243)
T ss_pred CCCCCcccceeeEec------------CCCcceEeehhhhHHhhc
Confidence 466666666667543 146778887777 44443
No 141
>KOG4466 consensus Component of histone deacetylase complex (breast carcinoma metastasis suppressor 1 protein in human) [Cell cycle control, cell division, chromosome partitioning; Transcription]
Probab=22.40 E-value=1.6e+03 Score=28.11 Aligned_cols=6 Identities=17% Similarity=0.075 Sum_probs=2.7
Q ss_pred Cccccc
Q 000153 780 SSTFIT 785 (2021)
Q Consensus 780 SSsF~P 785 (2021)
-+.|+|
T Consensus 194 ~s~~~P 199 (291)
T KOG4466|consen 194 ESAVQP 199 (291)
T ss_pred cCCCCC
Confidence 344444
No 142
>PF03154 Atrophin-1: Atrophin-1 family; InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA (OMIM:125370) is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins [, ]. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity [].. This entry includes Atrophin-1 and related proteins.
Probab=21.05 E-value=56 Score=45.00 Aligned_cols=9 Identities=22% Similarity=0.552 Sum_probs=4.2
Q ss_pred ccccccccc
Q 000153 902 ISSFGRSRY 910 (2021)
Q Consensus 902 ~~s~~r~ry 910 (2021)
+..+-|-|.
T Consensus 790 l~~lererl 798 (982)
T PF03154_consen 790 LNPLERERL 798 (982)
T ss_pred CChHHHHHH
Confidence 344445544
No 143
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]
Probab=20.98 E-value=2.7e+03 Score=30.29 Aligned_cols=17 Identities=24% Similarity=0.190 Sum_probs=8.4
Q ss_pred CCccccccccCCCCchh
Q 000153 185 DFPSLQAALPAASGSEK 201 (2021)
Q Consensus 185 dfpsl~a~~p~~~~~~~ 201 (2021)
||=-+|+-|+.+.++++
T Consensus 347 ~i~~~q~el~~~~~~e~ 363 (1072)
T KOG0979|consen 347 MILDAQAELQETEDPEN 363 (1072)
T ss_pred HHHHHHhhhhhcCCccc
Confidence 33344555555555544
No 144
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins. The function of HCR is unknown but it has been implicated in psoriasis in humans and is thought to affect keratinocyte proliferation [].; GO: 0030154 cell differentiation, 0005634 nucleus, 0005737 cytoplasm
Probab=20.26 E-value=2.5e+03 Score=29.53 Aligned_cols=135 Identities=20% Similarity=0.182 Sum_probs=0.0
Q ss_pred ccchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000153 563 FHDPVRESFEAELERVQKMQEQERQRIIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRK 642 (2021)
Q Consensus 563 ~EeKrREe~EaELERreKeqEEERKReEEEqKRreEEeRKEEEERERkeREEEERrRReEEErRErEErEEeEReEaERR 642 (2021)
+|...+.-.+..++.+.+.+.... +.+...+.++.-+.+.++........+..++.+|+.....-++..+.-.+.-..
T Consensus 78 le~e~~~lre~sl~qkmrLe~qa~--Ele~l~~ae~agraEae~Lraala~ae~~R~~lEE~~q~ELee~q~~Hqeql~~ 155 (739)
T PF07111_consen 78 LEEEVRALRETSLQQKMRLEAQAE--ELEALARAEKAGRAEAEELRAALAGAEVVRKNLEEGSQRELEEAQRLHQEQLSS 155 (739)
T ss_pred HHHHHHHHHHHHHHHHhHHHHHHH--HHHHHHHHHHhhhhhHHHHHHHHhhHHHHHHhhHHHHHHHHHHHHHHHHHHHHH
Q ss_pred HHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcchhhhh
Q 000153 643 AEEQRIAREEERQRIIMEEERRKHAAKQKLLELEERIAKRQAEAAKSDSNSSDIADE 699 (2021)
Q Consensus 643 EEEERrReEEEKRRreEEEERRKEEEEeKRkEeEEreKKeEaEaEKrereAeakaeE 699 (2021)
.-+.-.+.-..-..+.++-++.....+-++..+....+..+.|++..++......++
T Consensus 156 Lt~aHq~~l~sL~~k~~~Le~~L~~le~~r~~e~~~La~~q~e~d~L~~qLsk~~~~ 212 (739)
T PF07111_consen 156 LTQAHQEALASLTSKAEELEKSLESLETRRAGEAKELAEAQREADLLREQLSKTQEE 212 (739)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Done!