Query         000153
Match_columns 2021
No_of_seqs    362 out of 1477
Neff          3.4 
Searched_HMMs 46136
Date          Thu Mar 28 20:56:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/000153.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/000153hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0163 Myosin class VI heavy   99.2 9.4E-11   2E-15  143.4  12.0   25  839-863  1167-1191(1259)
  2 KOG1029 Endocytic adaptor prot  98.8 1.1E-07 2.3E-12  118.1  18.4   35  558-592   309-346 (1118)
  3 PF07001 BAT2_N:  BAT2 N-termin  98.6 2.9E-07 6.2E-12  101.5  10.6   69    8-102    16-84  (189)
  4 PTZ00121 MAEBL; Provisional     98.4   2E-06 4.4E-11  111.9  14.6    9   83-91    604-612 (2084)
  5 KOG1029 Endocytic adaptor prot  98.4 7.7E-06 1.7E-10  102.2  17.4   17   74-91     87-103 (1118)
  6 PTZ00121 MAEBL; Provisional     98.3 1.1E-05 2.3E-10  105.6  18.3   21  404-426   881-901 (2084)
  7 KOG4364 Chromatin assembly fac  98.2 0.00012 2.6E-09   91.3  23.2   44  808-853   491-536 (811)
  8 PTZ00266 NIMA-related protein   98.0   4E-05 8.8E-10  101.1  14.9   24  933-956   781-804 (1021)
  9 PTZ00266 NIMA-related protein   98.0 5.3E-05 1.2E-09  100.0  15.5   15   52-66     25-39  (1021)
 10 PRK09510 tolA cell envelope in  97.8  0.0011 2.5E-08   80.4  19.7    7  884-890   363-369 (387)
 11 KOG4364 Chromatin assembly fac  97.7  0.0005 1.1E-08   86.0  16.2   21 1272-1292  750-770 (811)
 12 KOG2891 Surface glycoprotein [  97.6  0.0025 5.5E-08   73.7  18.1    8  388-395   157-164 (445)
 13 COG3064 TolA Membrane protein   97.4  0.0061 1.3E-07   71.9  18.5    9  913-921   362-370 (387)
 14 COG3064 TolA Membrane protein   97.4  0.0031 6.7E-08   74.2  15.8   14  838-851   326-339 (387)
 15 KOG0163 Myosin class VI heavy   97.4  0.0018 3.8E-08   81.9  14.6   30  849-878  1213-1242(1259)
 16 KOG4661 Hsp27-ERE-TATA-binding  97.4  0.0077 1.7E-07   74.6  19.2   43  833-879   769-814 (940)
 17 KOG2891 Surface glycoprotein [  97.3  0.0038 8.3E-08   72.3  14.7   10  553-562   277-286 (445)
 18 PRK09510 tolA cell envelope in  97.3   0.015 3.2E-07   71.1  20.4   20  902-921   349-368 (387)
 19 KOG0742 AAA+-type ATPase [Post  97.2   0.038 8.2E-07   67.7  21.7   23  721-743   252-274 (630)
 20 TIGR02794 tolA_full TolA prote  97.2   0.021 4.5E-07   69.0  19.8   10  842-851   289-298 (346)
 21 PF05262 Borrelia_P83:  Borreli  97.2  0.0073 1.6E-07   75.4  15.9   12  469-480   107-119 (489)
 22 KOG2072 Translation initiation  96.9    0.14 3.1E-06   66.6  23.4   13  762-774   897-909 (988)
 23 KOG4661 Hsp27-ERE-TATA-binding  96.8  0.0081 1.8E-07   74.4  11.8   21  235-256   255-275 (940)
 24 KOG2412 Nuclear-export-signal   96.6   0.077 1.7E-06   66.6  17.9   33  806-838   420-452 (591)
 25 KOG1144 Translation initiation  96.4   0.011 2.4E-07   75.7   9.8   34 1101-1142  707-740 (1064)
 26 PF05262 Borrelia_P83:  Borreli  96.4   0.079 1.7E-06   66.7  16.6   12  877-888   477-488 (489)
 27 KOG2412 Nuclear-export-signal   96.2    0.11 2.5E-06   65.2  16.4   44  817-860   409-457 (591)
 28 PF12037 DUF3523:  Domain of un  95.6       1 2.2E-05   53.7  20.1    8  537-544    26-33  (276)
 29 KOG4817 Unnamed protein [Funct  94.9    0.56 1.2E-05   57.0  15.5   65    8-96     15-79  (468)
 30 PF09726 Macoilin:  Transmembra  94.7     0.7 1.5E-05   60.8  16.9    9  188-196   196-204 (697)
 31 KOG3054 Uncharacterized conser  94.5     0.3 6.5E-06   56.8  11.4   11  758-768   246-256 (299)
 32 KOG0742 AAA+-type ATPase [Post  94.3     1.4   3E-05   54.9  16.7    8  537-544    70-77  (630)
 33 KOG4722 Zn-finger protein [Gen  94.2    0.88 1.9E-05   56.0  14.7   27  449-476   188-214 (672)
 34 TIGR03319 YmdA_YtgF conserved   93.9    0.88 1.9E-05   58.0  15.0    6  780-785   249-254 (514)
 35 PRK00106 hypothetical protein;  93.8    0.82 1.8E-05   58.6  14.5    6  780-785   270-275 (535)
 36 PF00769 ERM:  Ezrin/radixin/mo  93.6     3.4 7.3E-05   48.4  17.9   15  574-588     9-23  (246)
 37 PRK00106 hypothetical protein;  93.3     5.5 0.00012   51.4  20.4    7  767-773   273-279 (535)
 38 PF09726 Macoilin:  Transmembra  93.1     2.2 4.8E-05   56.3  17.1    9  174-182   132-140 (697)
 39 PRK12705 hypothetical protein;  90.8     7.5 0.00016   50.0  17.5   13  547-559    21-33  (508)
 40 COG4942 Membrane-bound metallo  89.2      15 0.00033   46.3  17.8    6  787-792   358-363 (420)
 41 KOG1103 Predicted coiled-coil   88.6     5.3 0.00011   48.7  12.9   42  959-1011  450-491 (561)
 42 KOG3654 Uncharacterized CH dom  88.6     2.4 5.1E-05   53.5  10.3   20  201-220   115-134 (708)
 43 KOG0579 Ste20-like serine/thre  87.2      12 0.00025   49.2  15.2    8  347-354   575-582 (1187)
 44 KOG0579 Ste20-like serine/thre  85.7      33 0.00073   45.4  18.0   11  183-193   473-483 (1187)
 45 PF02029 Caldesmon:  Caldesmon;  85.4     3.2   7E-05   52.9   9.4   15  875-889   459-473 (492)
 46 PF12128 DUF3584:  Protein of u  85.1      18 0.00039   50.8  17.0    7 1228-1234 1167-1173(1201)
 47 PRK00409 recombination and DNA  84.8      27 0.00059   47.2  17.8   11  841-851   734-744 (782)
 48 KOG3634 Troponin [Cytoskeleton  84.2      12 0.00026   45.9  12.6    9  721-729   266-274 (361)
 49 TIGR01069 mutS2 MutS2 family p  84.1      25 0.00055   47.4  17.0   13  277-289   217-229 (771)
 50 PRK00409 recombination and DNA  83.7      24 0.00053   47.6  16.7   12  277-288   222-233 (782)
 51 PF09731 Mitofilin:  Mitochondr  83.0      81  0.0018   40.9  20.4    7  319-325    27-33  (582)
 52 TIGR01069 mutS2 MutS2 family p  82.4      31 0.00068   46.6  16.8    8  843-850   725-732 (771)
 53 KOG1265 Phospholipase C [Lipid  82.2      54  0.0012   44.8  18.1   15  318-333   752-767 (1189)
 54 PLN03086 PRLI-interacting fact  82.0     7.8 0.00017   50.4  10.8   10  816-825   185-194 (567)
 55 KOG0161 Myosin class II heavy   80.8      53  0.0011   48.4  18.8   12  498-509   699-710 (1930)
 56 PTZ00491 major vault protein;   80.8      37  0.0008   46.2  16.3   10  150-159   198-207 (850)
 57 KOG1103 Predicted coiled-coil   80.6      59  0.0013   40.3  16.5   10  500-509    55-64  (561)
 58 KOG3654 Uncharacterized CH dom  80.0      11 0.00025   47.8  10.8   17   75-91     17-33  (708)
 59 KOG2689 Predicted ubiquitin re  79.8      14 0.00031   44.3  11.1    6  803-808   254-259 (290)
 60 KOG2507 Ubiquitin regulatory p  79.6     4.4 9.4E-05   50.7   7.2    8  907-914   464-471 (506)
 61 PF06098 Radial_spoke_3:  Radia  78.9      18 0.00038   44.0  11.7   15  335-349     2-16  (291)
 62 KOG4848 Extracellular matrix-a  77.1 1.5E+02  0.0032   34.7  17.3   11  469-479    71-81  (225)
 63 PF06637 PV-1:  PV-1 protein (P  76.5      62  0.0013   40.7  15.3   10  723-732   419-428 (442)
 64 PLN02316 synthase/transferase   76.4      30 0.00065   48.2  14.1   24  768-791   509-534 (1036)
 65 KOG0982 Centrosomal protein Nu  75.1 2.2E+02  0.0047   36.8  19.4   12  549-560   225-236 (502)
 66 KOG0994 Extracellular matrix g  74.6 1.1E+02  0.0024   43.0  17.8   63  162-231  1193-1260(1758)
 67 KOG2689 Predicted ubiquitin re  73.2      29 0.00062   42.0  11.2   12  810-821   250-261 (290)
 68 KOG3634 Troponin [Cytoskeleton  73.2      26 0.00055   43.2  10.9    7  679-685   204-210 (361)
 69 KOG0681 Actin-related protein   72.6      23  0.0005   46.0  10.8    6  469-474   149-154 (645)
 70 KOG1265 Phospholipase C [Lipid  71.5 1.7E+02  0.0037   40.4  18.3   10  399-408   795-804 (1189)
 71 PTZ00491 major vault protein;   71.1      93   0.002   42.7  16.2    9  150-158   145-153 (850)
 72 KOG1363 Predicted regulator of  70.2      25 0.00055   45.0  10.6   11  291-301    63-73  (460)
 73 KOG0161 Myosin class II heavy   69.9 1.4E+02  0.0031   44.4  18.5    9  185-193   302-310 (1930)
 74 KOG0994 Extracellular matrix g  69.6      87  0.0019   44.0  15.2   11   52-62    645-655 (1758)
 75 COG2433 Uncharacterized conser  69.5   1E+02  0.0022   40.9  15.5   12  453-464   266-277 (652)
 76 KOG2441 mRNA splicing factor/p  68.5      34 0.00074   42.9  10.7   49  730-785   395-444 (506)
 77 KOG0982 Centrosomal protein Nu  67.6 2.6E+02  0.0056   36.2  17.8   15  492-506   170-184 (502)
 78 KOG0288 WD40 repeat protein Ti  66.6 2.8E+02   0.006   35.8  17.8   21  723-743   156-176 (459)
 79 PRK13428 F0F1 ATP synthase sub  66.6 1.4E+02   0.003   38.2  16.0    7  841-847   258-264 (445)
 80 KOG3756 Pinin (desmosome-assoc  64.8 3.6E+02  0.0079   33.7  18.1    6  381-386    58-63  (340)
 81 PRK04863 mukB cell division pr  64.0 2.6E+02  0.0057   41.0  19.3   11 1288-1298  830-840 (1486)
 82 PF10168 Nup88:  Nuclear pore c  63.8 1.7E+02  0.0036   39.9  16.5   15   81-95     83-97  (717)
 83 KOG0933 Structural maintenance  63.0 3.6E+02  0.0078   38.1  18.9   18  537-554   662-679 (1174)
 84 KOG0681 Actin-related protein   62.6      44 0.00095   43.6  10.4    6  281-286    23-28  (645)
 85 KOG4572 Predicted DNA-binding   62.5 1.4E+02  0.0031   40.5  14.9   15   69-84    229-243 (1424)
 86 KOG0921 Dosage compensation co  62.0      13 0.00029   50.2   6.2   25   36-60   1204-1232(1282)
 87 KOG2668 Flotillins [Intracellu  61.6 3.4E+02  0.0073   34.5  17.0    8  741-748   398-405 (428)
 88 PRK04863 mukB cell division pr  61.0 2.5E+02  0.0054   41.3  18.2   37  839-876   730-768 (1486)
 89 PRK12472 hypothetical protein;  60.8 1.1E+02  0.0023   39.9  13.2    8  515-522   136-143 (508)
 90 PF05914 RIB43A:  RIB43A;  Inte  60.8 4.5E+02  0.0098   33.5  19.1   14  541-554   140-153 (379)
 91 PF10168 Nup88:  Nuclear pore c  60.4 3.9E+02  0.0085   36.6  19.0    9  449-457   395-403 (717)
 92 TIGR02680 conserved hypothetic  58.1 3.3E+02  0.0071   39.6  18.7    6  361-366    57-62  (1353)
 93 PRK12472 hypothetical protein;  57.1 1.9E+02  0.0041   37.8  14.5    9  908-916   480-488 (508)
 94 COG2433 Uncharacterized conser  56.8 1.1E+02  0.0024   40.6  12.6    6  308-313    99-104 (652)
 95 TIGR02680 conserved hypothetic  56.6 3.2E+02   0.007   39.7  18.3   11 1496-1506 1246-1256(1353)
 96 KOG4722 Zn-finger protein [Gen  54.8 4.6E+02  0.0099   33.9  16.7   17  189-205    82-98  (672)
 97 TIGR02169 SMC_prok_A chromosom  54.8   5E+02   0.011   36.1  19.1    9  779-787   573-581 (1164)
 98 PF05667 DUF812:  Protein of un  53.8 4.1E+02  0.0089   35.7  17.3    9  187-195    47-55  (594)
 99 KOG3915 Transcription regulato  53.1 1.5E+02  0.0032   38.3  12.4   20   36-55     71-90  (641)
100 KOG0976 Rho/Rac1-interacting s  53.1 3.8E+02  0.0083   37.0  16.4   13 1534-1546 1197-1209(1265)
101 PF06936 Selenoprotein_S:  Sele  53.0      77  0.0017   36.7   9.5    6  524-529    17-22  (190)
102 PRK03918 chromosome segregatio  52.1   7E+02   0.015   34.1  19.6   12  347-358    30-41  (880)
103 KOG0288 WD40 repeat protein Ti  51.6 6.7E+02   0.014   32.6  17.9   15  997-1011  383-397 (459)
104 TIGR02169 SMC_prok_A chromosom  51.0 6.1E+02   0.013   35.2  19.0    6  350-355    33-38  (1164)
105 KOG2894 Uncharacterized conser  50.3 1.7E+02  0.0037   35.8  11.9   10  729-738   256-265 (331)
106 KOG0612 Rho-associated, coiled  48.9 3.5E+02  0.0075   38.9  15.7   27  424-450   309-335 (1317)
107 PF15359 CDV3:  Carnitine defic  48.7      44 0.00095   36.6   6.4   63  116-193    59-123 (129)
108 COG5269 ZUO1 Ribosome-associat  46.8 2.2E+02  0.0048   34.9  12.1   13  724-736   341-353 (379)
109 KOG0612 Rho-associated, coiled  46.0 7.6E+02   0.016   35.9  18.1   15 1315-1329 1205-1220(1317)
110 KOG2129 Uncharacterized conser  45.9 7.7E+02   0.017   32.1  16.8   28  866-893   473-500 (552)
111 KOG0980 Actin-binding protein   45.6 7.5E+02   0.016   34.8  17.6    8  526-533   312-319 (980)
112 KOG3973 Uncharacterized conser  44.4      37  0.0008   42.1   5.6   29   71-99    310-338 (465)
113 KOG2441 mRNA splicing factor/p  44.3      46   0.001   41.9   6.4    9  732-740   412-420 (506)
114 COG1196 Smc Chromosome segrega  43.9 1.1E+03   0.023   34.1  19.9   18  858-875   600-617 (1163)
115 KOG0996 Structural maintenance  43.8 8.7E+02   0.019   35.2  18.1    7 1228-1234 1168-1174(1293)
116 KOG3915 Transcription regulato  42.1 1.7E+02  0.0038   37.8  10.8    8  177-184   178-185 (641)
117 KOG0976 Rho/Rac1-interacting s  40.7 1.2E+03   0.026   32.7  18.0   23 1269-1296  971-993 (1265)
118 PLN03188 kinesin-12 family pro  40.5 1.4E+03    0.03   33.7  19.4   23  407-429   671-693 (1320)
119 PF12004 DUF3498:  Domain of un  38.5      10 0.00022   48.7   0.0    8  379-386   236-243 (495)
120 KOG0971 Microtubule-associated  37.9 5.5E+02   0.012   36.1  14.7   15 1328-1342 1108-1122(1243)
121 KOG3973 Uncharacterized conser  35.5      26 0.00056   43.3   2.6   20   36-55    441-460 (465)
122 KOG0249 LAR-interacting protei  34.7   6E+02   0.013   35.0  14.1   12  912-923   440-451 (916)
123 KOG0250 DNA repair protein RAD  34.7 1.4E+03    0.03   33.1  17.9   31  887-918   617-650 (1074)
124 COG4499 Predicted membrane pro  34.6      90   0.002   39.5   6.9   21  548-568   347-367 (434)
125 COG1196 Smc Chromosome segrega  32.5 1.8E+03   0.038   32.0  19.4    8  779-786   567-574 (1163)
126 COG0419 SbcC ATPase involved i  31.7 1.6E+03   0.035   31.4  19.5   11  349-359    34-44  (908)
127 KOG0345 ATP-dependent RNA heli  29.9 2.1E+02  0.0046   37.5   9.0   15  373-387   349-363 (567)
128 KOG2505 Ankyrin repeat protein  29.6 2.2E+02  0.0047   37.4   9.0    8  213-220   103-110 (591)
129 KOG0804 Cytoplasmic Zn-finger   29.1 9.5E+02   0.021   31.6  14.2  113  595-707   329-443 (493)
130 COG5269 ZUO1 Ribosome-associat  28.7 7.2E+02   0.016   30.9  12.5   12  271-282    16-27  (379)
131 PF00901 Orbi_VP5:  Orbivirus o  28.6 1.6E+03   0.034   30.1  17.9   10  551-560    89-98  (508)
132 KOG3598 Thyroid hormone recept  28.0 1.5E+02  0.0031   42.8   7.6   12  376-387  1924-1935(2220)
133 KOG0577 Serine/threonine prote  28.0 1.2E+03   0.027   32.0  15.2   14  261-274   210-223 (948)
134 KOG3598 Thyroid hormone recept  26.8 1.6E+02  0.0035   42.5   7.7    6  153-158  1772-1777(2220)
135 KOG4715 SWI/SNF-related matrix  25.4 1.9E+02  0.0042   35.9   7.3   12  279-290    25-36  (410)
136 PLN03188 kinesin-12 family pro  25.3 2.2E+03   0.047   31.9  17.6   12   70-81     65-76  (1320)
137 KOG0249 LAR-interacting protei  24.4 1.6E+03   0.035   31.3  15.4   21 1486-1506  816-836 (916)
138 KOG3878 Protein involved in ma  24.3 1.5E+03   0.033   28.9  14.3    7  768-774   301-307 (469)
139 PF03154 Atrophin-1:  Atrophin-  23.8      43 0.00093   46.0   1.9    8  756-763   667-674 (982)
140 KOG0971 Microtubule-associated  22.9 2.4E+03   0.053   30.5  19.1   32  308-351    46-78  (1243)
141 KOG4466 Component of histone d  22.4 1.6E+03   0.034   28.1  14.8    6  780-785   194-199 (291)
142 PF03154 Atrophin-1:  Atrophin-  21.1      56  0.0012   45.0   2.1    9  902-910   790-798 (982)
143 KOG0979 Structural maintenance  21.0 2.7E+03   0.059   30.3  18.4   17  185-201   347-363 (1072)
144 PF07111 HCR:  Alpha helical co  20.3 2.5E+03   0.053   29.5  18.0  135  563-699    78-212 (739)

No 1  
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=99.18  E-value=9.4e-11  Score=143.36  Aligned_cols=25  Identities=24%  Similarity=0.466  Sum_probs=23.0

Q ss_pred             ccCCcccccCCCCccccccccCccc
Q 000153          839 SRGQRWNMSGDGDHYGRNIEMESDF  863 (2021)
Q Consensus       839 ~~p~~W~apgDGd~igRq~E~dSd~  863 (2021)
                      .+.+|||+||||+||.|||++|++-
T Consensus      1167 ~k~gmWyaHFdGq~I~RQm~l~~~k 1191 (1259)
T KOG0163|consen 1167 TKRGMWYAHFDGQWIARQMELHPDK 1191 (1259)
T ss_pred             CccceEEEecCcHHHHhhheecCCC
Confidence            6789999999999999999999863


No 2  
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.81  E-value=1.1e-07  Score=118.05  Aligned_cols=35  Identities=40%  Similarity=0.548  Sum_probs=26.0

Q ss_pred             cccccccchhhhhHH---HHHHHHHHHHHHHHHHHHHH
Q 000153          558 LKQTDFHDPVRESFE---AELERVQKMQEQERQRIIEE  592 (2021)
Q Consensus       558 lkq~e~EeKrREe~E---aELERreKeqEEERKReEEE  592 (2021)
                      .....||+|++++++   +||+|+++.++++.+|+.++
T Consensus       309 P~~~TFEDKrkeNy~kGqaELerRRq~leeqqqreree  346 (1118)
T KOG1029|consen  309 PAPVTFEDKRKENYEKGQAELERRRQALEEQQQREREE  346 (1118)
T ss_pred             CCCcchhhhhHHhHhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            445779999999998   88998777777666554443


No 3  
>PF07001 BAT2_N:  BAT2 N-terminus;  InterPro: IPR009738 This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2. BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [].
Probab=98.56  E-value=2.9e-07  Score=101.54  Aligned_cols=69  Identities=35%  Similarity=0.485  Sum_probs=47.8

Q ss_pred             cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeeccCccccccCCccccCCCCCCCcccccc
Q 000153            8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH   87 (2021)
Q Consensus         8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh   87 (2021)
                      .||.++|||..|--.+.--+                  -....-..||.+|++=      +.. --||||.||||||.||
T Consensus        16 ~Ky~~l~in~~YkGks~e~q------------------k~~~~~~hGmqsLGKv------~~a-RRmPpPaNLPSLKaEn   70 (189)
T PF07001_consen   16 PKYSSLNINSLYKGKSLEPQ------------------KSTVPRRHGMQSLGKV------PSA-RRMPPPANLPSLKAEN   70 (189)
T ss_pred             ccceeechhhhhcCCccccc------------------cCCccCCCcceecccc------ccc-ccCCCCCCCcchhhhc
Confidence            38999999999933332210                  0122237799999982      111 1289999999999999


Q ss_pred             cccCCCCCCCCCCCC
Q 000153           88 ERFDSSGSNGGPAGG  102 (2021)
Q Consensus        88 ~~~d~~~~~~~~~~~  102 (2021)
                      .++|++-.. +|.+|
T Consensus        71 ~GnDpnv~l-VP~~G   84 (189)
T PF07001_consen   71 KGNDPNVSL-VPKGG   84 (189)
T ss_pred             cCCCCCcee-ecCCC
Confidence            999977766 56543


No 4  
>PTZ00121 MAEBL; Provisional
Probab=98.42  E-value=2e-06  Score=111.90  Aligned_cols=9  Identities=56%  Similarity=0.663  Sum_probs=5.6

Q ss_pred             ccccccccC
Q 000153           83 LRKEHERFD   91 (2021)
Q Consensus        83 lrkeh~~~d   91 (2021)
                      --+.-+|||
T Consensus       604 q~~~m~rfd  612 (2084)
T PTZ00121        604 QQKFMERFD  612 (2084)
T ss_pred             HHHHHHhcC
Confidence            445666777


No 5  
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.37  E-value=7.7e-06  Score=102.25  Aligned_cols=17  Identities=47%  Similarity=0.677  Sum_probs=9.3

Q ss_pred             cCCCCCCCcccccccccC
Q 000153           74 VPPPLNLPSLRKEHERFD   91 (2021)
Q Consensus        74 vp~plnlpslrkeh~~~d   91 (2021)
                      ||+-|- |||-|---+|-
T Consensus        87 lP~~LP-Psll~~~~~~~  103 (1118)
T KOG1029|consen   87 LPPVLP-PSLLKQPPRNA  103 (1118)
T ss_pred             CCCCCC-hHHhccCCcCC
Confidence            344333 56777666655


No 6  
>PTZ00121 MAEBL; Provisional
Probab=98.35  E-value=1.1e-05  Score=105.61  Aligned_cols=21  Identities=19%  Similarity=0.158  Sum_probs=9.1

Q ss_pred             CccccCCccccccccccccccCc
Q 000153          404 GICERPSSLNREANKETKFMSSP  426 (2021)
Q Consensus       404 GigvRp~S~~R~~tKe~kY~~sp  426 (2021)
                      ..|.+|  +.-...|+=-|+++-
T Consensus       881 p~Cf~p--~Kt~~~KnwtYvSSf  901 (2084)
T PTZ00121        881 PNCQII--RKTLDSKDWTYVSSF  901 (2084)
T ss_pred             Cccccc--ccccccccceeeccc
Confidence            444444  333444444444443


No 7  
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=98.24  E-value=0.00012  Score=91.35  Aligned_cols=44  Identities=18%  Similarity=0.296  Sum_probs=27.6

Q ss_pred             CcccCCCCCcccccCccccccccc--cccccccccCCcccccCCCCcc
Q 000153          808 RKEFYGGPGIMSSRNYYKAGILEP--HMDEFTVSRGQRWNMSGDGDHY  853 (2021)
Q Consensus       808 r~efyggagFvsK~PY~~gGttD~--hLdDY~~~~p~~W~apgDGd~i  853 (2021)
                      |..|||.|+--++  .+.++.+-.  .+.||.++.+..|-....|.-+
T Consensus       491 RP~YyGTWrKKS~--~VsarrPlAq~~llDYEVdSDeEWEEEepGESl  536 (811)
T KOG4364|consen  491 RPGYYGTWRKKSQ--VVSARRPLAQDPLLDYEVDSDEEWEEEEPGESL  536 (811)
T ss_pred             CCccccccccccc--ccccCCcccccccccccccCcccccccCCCccc
Confidence            4678888764333  355544433  5568888888888766666533


No 8  
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=98.04  E-value=4e-05  Score=101.13  Aligned_cols=24  Identities=29%  Similarity=0.173  Sum_probs=13.6

Q ss_pred             CCcCCCCCCccccccccccccccc
Q 000153          933 RENECPSPSTFQENEVEYNRLLRS  956 (2021)
Q Consensus       933 ~~~~~p~ps~f~~~~~~~~~~~r~  956 (2021)
                      .++.-|+=++=+--++.|+|.-+.
T Consensus       781 ~~~~~~~~~~~~~~~~~~~~~~~~  804 (1021)
T PTZ00266        781 KEAVNPICSAEAHYERVYNHGNRG  804 (1021)
T ss_pred             hhhccchhccCCchhccccCCccc
Confidence            344555555545566667665554


No 9  
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=98.03  E-value=5.3e-05  Score=100.05  Aligned_cols=15  Identities=20%  Similarity=0.286  Sum_probs=9.2

Q ss_pred             CCceEEeeccCcccc
Q 000153           52 GGGMLVLSRPRSSQK   66 (2021)
Q Consensus        52 ~ggm~vlsr~r~~~~   66 (2021)
                      +=|.|.|.+.+.+..
T Consensus        25 gFGtVYLAkdk~tg~   39 (1021)
T PTZ00266         25 RFGEVFLVKHKRTQE   39 (1021)
T ss_pred             CCeEEEEEEECCCCe
Confidence            445677777665543


No 10 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.79  E-value=0.0011  Score=80.36  Aligned_cols=7  Identities=29%  Similarity=0.349  Sum_probs=2.9

Q ss_pred             CCCCCCC
Q 000153          884 NVHPPYP  890 (2021)
Q Consensus       884 rp~PP~p  890 (2021)
                      .++|++|
T Consensus       363 a~lP~pP  369 (387)
T PRK09510        363 AKIPKPP  369 (387)
T ss_pred             CCCCCCC
Confidence            4444443


No 11 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.75  E-value=0.0005  Score=86.02  Aligned_cols=21  Identities=29%  Similarity=0.199  Sum_probs=12.4

Q ss_pred             CCccceEEEeecccCCCCCCC
Q 000153         1272 QAETPVKLQFGLFSGPSLIPS 1292 (2021)
Q Consensus      1272 ~~e~pv~lqfglfsgpslips 1292 (2021)
                      +.-++|+-|+-.-.||+--|.
T Consensus       750 ~~~lqv~~qw~y~l~~~~sp~  770 (811)
T KOG4364|consen  750 DSRLQVKKQWLYKLGLSPSPD  770 (811)
T ss_pred             cccccccceeeeeecCCCCCC
Confidence            456677777766666554333


No 12 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.62  E-value=0.0025  Score=73.69  Aligned_cols=8  Identities=13%  Similarity=0.110  Sum_probs=4.5

Q ss_pred             ccccCccc
Q 000153          388 LQKDGFGA  395 (2021)
Q Consensus       388 l~K~w~~a  395 (2021)
                      |+-.||.-
T Consensus       157 ip~kwf~l  164 (445)
T KOG2891|consen  157 IPCKWFAL  164 (445)
T ss_pred             Ccceeeee
Confidence            45557754


No 13 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.45  E-value=0.0061  Score=71.86  Aligned_cols=9  Identities=22%  Similarity=0.770  Sum_probs=3.5

Q ss_pred             CCCCCCCCC
Q 000153          913 RHPRVLPPP  921 (2021)
Q Consensus       913 rqprvlppp  921 (2021)
                      |+-.||+||
T Consensus       362 k~~kiP~pp  370 (387)
T COG3064         362 KTAKIPKPP  370 (387)
T ss_pred             HhccCCCCC
Confidence            333344433


No 14 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.42  E-value=0.0031  Score=74.21  Aligned_cols=14  Identities=21%  Similarity=0.295  Sum_probs=6.0

Q ss_pred             cccCCcccccCCCC
Q 000153          838 VSRGQRWNMSGDGD  851 (2021)
Q Consensus       838 ~~~p~~W~apgDGd  851 (2021)
                      +.|.-.+-.-.||.
T Consensus       326 K~C~l~ikL~pdGt  339 (387)
T COG3064         326 KTCRLRIKLAPDGT  339 (387)
T ss_pred             ceeEEEEEEcCCcc
Confidence            34444444444444


No 15 
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=97.42  E-value=0.0018  Score=81.88  Aligned_cols=30  Identities=23%  Similarity=0.195  Sum_probs=17.9

Q ss_pred             CCCccccccccCcccccccccccCCccccC
Q 000153          849 DGDHYGRNIEMESDFHENITERYGDVGWGQ  878 (2021)
Q Consensus       849 DGd~igRq~E~dSd~~~n~~erfGdsgW~~  878 (2021)
                      .|.+-.|--||-+.=|+..-+|+|+-.+-.
T Consensus      1213 TgL~rKrGAEI~~~eFe~~W~r~Ggk~~~~ 1242 (1259)
T KOG0163|consen 1213 TGLTRKRGAEILEHEFEREWERNGGKAYKN 1242 (1259)
T ss_pred             hccccccccccChHHHHHHHHHhCcHHhHh
Confidence            345555555665555555558888765554


No 16 
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=97.39  E-value=0.0077  Score=74.60  Aligned_cols=43  Identities=19%  Similarity=0.292  Sum_probs=23.7

Q ss_pred             ccccccccCCcccccCCCCccccccccC---cccccccccccCCccccCC
Q 000153          833 MDEFTVSRGQRWNMSGDGDHYGRNIEME---SDFHENITERYGDVGWGQG  879 (2021)
Q Consensus       833 LdDY~~~~p~~W~apgDGd~igRq~E~d---Sd~~~n~~erfGdsgW~~s  879 (2021)
                      --||+.....+-+-|.+|+++......+   +++|-+  +  .--+|+..
T Consensus       769 s~DrregSrsmmgd~regqHyp~~~~~hGGp~erHgr--d--srdGwgGy  814 (940)
T KOG4661|consen  769 SNDRREGSRSMMGDYREGQHYPLSGTVHGGPSERHGR--D--SRDGWGGY  814 (940)
T ss_pred             ccccccccccccccchhhcccCccCccCCCchhhccC--c--cCCCcccc
Confidence            4456666666666666777666663333   344444  2  23367763


No 17 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.32  E-value=0.0038  Score=72.29  Aligned_cols=10  Identities=20%  Similarity=0.388  Sum_probs=3.8

Q ss_pred             hhhhhccccc
Q 000153          553 KKKDVLKQTD  562 (2021)
Q Consensus       553 KKKEelkq~e  562 (2021)
                      |..++.++.+
T Consensus       277 kraeerrqie  286 (445)
T KOG2891|consen  277 KRAEERRQIE  286 (445)
T ss_pred             HHHHHHhhhh
Confidence            3334333333


No 18 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.31  E-value=0.015  Score=71.06  Aligned_cols=20  Identities=10%  Similarity=0.257  Sum_probs=10.5

Q ss_pred             cccccccccccCCCCCCCCC
Q 000153          902 ISSFGRSRYSMRHPRVLPPP  921 (2021)
Q Consensus       902 ~~s~~r~rys~rqprvlppp  921 (2021)
                      ...|||.=.....-.+||+|
T Consensus       349 d~aldrAA~~Aar~a~lP~p  368 (387)
T PRK09510        349 DPALCQAALAAAKTAKIPKP  368 (387)
T ss_pred             CHHHHHHHHHHHHcCCCCCC
Confidence            34678754444333445544


No 19 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=97.19  E-value=0.038  Score=67.70  Aligned_cols=23  Identities=26%  Similarity=0.351  Sum_probs=13.8

Q ss_pred             hhhhhhhhccccCCCCCCCCCCc
Q 000153          721 DGERMVERITTSASSDSSGLHRS  743 (2021)
Q Consensus       721 D~ERmVERI~TSSSsDSs~~NR~  743 (2021)
                      +.+..++.|+|.-+.=-..++-+
T Consensus       252 eRekwl~aInTtf~higgG~r~~  274 (630)
T KOG0742|consen  252 EREKWLEAINTTFTHIGGGLRAF  274 (630)
T ss_pred             HHHHHHHHHhhhHHHhhhHHHHH
Confidence            45567888888765544433333


No 20 
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=97.19  E-value=0.021  Score=69.00  Aligned_cols=10  Identities=30%  Similarity=0.508  Sum_probs=4.3

Q ss_pred             CcccccCCCC
Q 000153          842 QRWNMSGDGD  851 (2021)
Q Consensus       842 ~~W~apgDGd  851 (2021)
                      -.+.+..||.
T Consensus       289 V~I~L~pdG~  298 (346)
T TIGR02794       289 LRIRLAPDGT  298 (346)
T ss_pred             EEEEECCCCC
Confidence            3344444443


No 21 
>PF05262 Borrelia_P83:  Borrelia P83/100 protein;  InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=97.15  E-value=0.0073  Score=75.44  Aligned_cols=12  Identities=33%  Similarity=0.454  Sum_probs=6.5

Q ss_pred             ccccccccc-ccC
Q 000153          469 QYGSEQYNR-FRG  480 (2021)
Q Consensus       469 ~yg~~qy~r-YrG  480 (2021)
                      +.||-.||- |||
T Consensus       107 A~fit~YNAv~R~  119 (489)
T PF05262_consen  107 ATFITIYNAVYRG  119 (489)
T ss_pred             HHHHHHHHHHHcC
Confidence            455666664 444


No 22 
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=96.85  E-value=0.14  Score=66.59  Aligned_cols=13  Identities=38%  Similarity=0.654  Sum_probs=8.1

Q ss_pred             cCCCCCCcccccc
Q 000153          762 DRGKPFNSWRRDA  774 (2021)
Q Consensus       762 dR~K~~nswrR~~  774 (2021)
                      .|.-+.+.|+|-.
T Consensus       897 ~~a~~~~~WrR~a  909 (988)
T KOG2072|consen  897 PRAPEEAEWRRGA  909 (988)
T ss_pred             CCCCcchHHhhcc
Confidence            3444566788876


No 23 
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.80  E-value=0.0081  Score=74.42  Aligned_cols=21  Identities=10%  Similarity=-0.023  Sum_probs=13.8

Q ss_pred             CCCcccccCCCcccCCccccCC
Q 000153          235 DGMSPRLQSGQDVVGSRLRENG  256 (2021)
Q Consensus       235 ~~m~pq~~~~~~~~g~~~~~~~  256 (2021)
                      --..|-+.+-+.+.|.+ ++++
T Consensus       255 aeeedlfdSahpeegDl-Dlas  275 (940)
T KOG4661|consen  255 AEEEDLFDSAHPEEGDL-DLAS  275 (940)
T ss_pred             hhccccccccCCccccc-cccc
Confidence            34566677778888876 5444


No 24 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=96.57  E-value=0.077  Score=66.58  Aligned_cols=33  Identities=6%  Similarity=-0.054  Sum_probs=26.4

Q ss_pred             CCCcccCCCCCcccccCcccccccccccccccc
Q 000153          806 VPRKEFYGGPGIMSSRNYYKAGILEPHMDEFTV  838 (2021)
Q Consensus       806 ppr~efyggagFvsK~PY~~gGttD~hLdDY~~  838 (2021)
                      ||+.--...+.+.|+|||..++.++...++|.+
T Consensus       420 ~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k  452 (591)
T KOG2412|consen  420 FPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQK  452 (591)
T ss_pred             CchHHHHHHHHHHhcCCccccccccCcHHHHHH
Confidence            566666677889999999999988877777753


No 25 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.43  E-value=0.011  Score=75.72  Aligned_cols=34  Identities=24%  Similarity=0.245  Sum_probs=15.4

Q ss_pred             ccCCCCCcccccchhhhhcccccccCCCCcccceeeeccCce
Q 000153         1101 EDVPEGDDENIELTQEFEGIHLEEKGSPHMMSNLVLGFNEGV 1142 (2021)
Q Consensus      1101 ed~~~~~den~~l~~e~~~~hl~~k~~p~~~~~~vlgf~egv 1142 (2021)
                      .-.|++--.-||.-  +.|.-|      |+=|-+|||=-.|-
T Consensus       707 VKvieG~GtTIDVi--LvNG~L------~eGD~IvvcG~~Gp  740 (1064)
T KOG1144|consen  707 VKVIEGHGTTIDVI--LVNGEL------HEGDQIVVCGLQGP  740 (1064)
T ss_pred             EEeecCCCceEEEE--EEccee------ccCCEEEEcCCCCc
Confidence            33444445566543  233332      33356666543443


No 26 
>PF05262 Borrelia_P83:  Borrelia P83/100 protein;  InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=96.37  E-value=0.079  Score=66.65  Aligned_cols=12  Identities=0%  Similarity=-0.153  Sum_probs=5.9

Q ss_pred             cCCCCCCCCCCC
Q 000153          877 GQGRYRGNVHPP  888 (2021)
Q Consensus       877 ~~ssS~~rp~PP  888 (2021)
                      +.|.-...||.|
T Consensus       477 a~S~~eV~P~T~  488 (489)
T PF05262_consen  477 AKSEVEVLPFTS  488 (489)
T ss_pred             hcCccccCCCCC
Confidence            344555555544


No 27 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=96.19  E-value=0.11  Score=65.19  Aligned_cols=44  Identities=5%  Similarity=-0.033  Sum_probs=28.7

Q ss_pred             cccccCccccccccc---cccccccccCCcccccCCCC--ccccccccC
Q 000153          817 IMSSRNYYKAGILEP---HMDEFTVSRGQRWNMSGDGD--HYGRNIEME  860 (2021)
Q Consensus       817 FvsK~PY~~gGttD~---hLdDY~~~~p~~W~apgDGd--~igRq~E~d  860 (2021)
                      |.+.+.|+--.++|-   .|+.+++.||=...++-+.+  ...+.|+|.
T Consensus       409 la~V~l~i~~q~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~mGyk  457 (591)
T KOG2412|consen  409 LAKVILYIWSQFPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMMGYK  457 (591)
T ss_pred             HHHHHHHHHHhCchHHHHHHHHHHhcCCccccccccCcHHHHHHhhccc
Confidence            446666666666665   77999999976666555555  444555553


No 28 
>PF12037 DUF3523:  Domain of unknown function (DUF3523);  InterPro: IPR021911  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif. 
Probab=95.63  E-value=1  Score=53.66  Aligned_cols=8  Identities=38%  Similarity=0.463  Sum_probs=4.7

Q ss_pred             CCCCCCcc
Q 000153          537 FDGRDPFS  544 (2021)
Q Consensus       537 fDG~Dpf~  544 (2021)
                      ..+|||..
T Consensus        26 ~~~FDP~a   33 (276)
T PF12037_consen   26 ASGFDPEA   33 (276)
T ss_pred             cCCCCcHH
Confidence            44677663


No 29 
>KOG4817 consensus Unnamed protein [Function unknown]
Probab=94.94  E-value=0.56  Score=57.00  Aligned_cols=65  Identities=32%  Similarity=0.436  Sum_probs=42.3

Q ss_pred             cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeeccCccccccCCccccCCCCCCCcccccc
Q 000153            8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH   87 (2021)
Q Consensus         8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh   87 (2021)
                      .||--|-||..|--.-.-           .+-      ..-..-+-||-.|.+      + ..---.|||-||||||-|-
T Consensus        15 ~K~talsin~~ykg~~~~-----------~aq------R~~vp~RhGmQslGK------a-~v~rrmpPPAnLPSLkaEn   70 (468)
T KOG4817|consen   15 PKFTALSINRMYKGSREP-----------SAQ------RNQVPRRHGMQSLGK------A-KVPRRMPPPANLPSLKAEN   70 (468)
T ss_pred             cCcceeehhhhhcCCcCC-----------ccc------ccCCCccchhhhhcc------c-cccccCCCCCCCcchhhcc
Confidence            588888888888433100           000      122233678877764      1 2223579999999999999


Q ss_pred             cccCCCCCC
Q 000153           88 ERFDSSGSN   96 (2021)
Q Consensus        88 ~~~d~~~~~   96 (2021)
                      -+.|++-..
T Consensus        71 ~g~dpn~~l   79 (468)
T KOG4817|consen   71 HGSDPNNLL   79 (468)
T ss_pred             cCCCCCcee
Confidence            999987543


No 30 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=94.71  E-value=0.7  Score=60.77  Aligned_cols=9  Identities=56%  Similarity=0.693  Sum_probs=4.4

Q ss_pred             cccccccCC
Q 000153          188 SLQAALPAA  196 (2021)
Q Consensus       188 sl~a~~p~~  196 (2021)
                      .|+-+||+.
T Consensus       196 ~l~~~lp~~  204 (697)
T PF09726_consen  196 LLQQALPPE  204 (697)
T ss_pred             HHHHhCCCc
Confidence            345555544


No 31 
>KOG3054 consensus Uncharacterized conserved protein [Function unknown]
Probab=94.52  E-value=0.3  Score=56.77  Aligned_cols=11  Identities=36%  Similarity=0.296  Sum_probs=5.9

Q ss_pred             CccccCCCCCC
Q 000153          758 SGFLDRGKPFN  768 (2021)
Q Consensus       758 SpfldR~K~~n  768 (2021)
                      ..+-||+|++-
T Consensus       246 GVmDDRGKfIY  256 (299)
T KOG3054|consen  246 GVMDDRGKFIY  256 (299)
T ss_pred             eeecCCCceEE
Confidence            34457766443


No 32 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=94.26  E-value=1.4  Score=54.91  Aligned_cols=8  Identities=38%  Similarity=0.708  Sum_probs=4.7

Q ss_pred             CCCCCCcc
Q 000153          537 FDGRDPFS  544 (2021)
Q Consensus       537 fDG~Dpf~  544 (2021)
                      +.++||..
T Consensus        70 ~~gFDpea   77 (630)
T KOG0742|consen   70 WSGFDPEA   77 (630)
T ss_pred             ccCCChHH
Confidence            45677653


No 33 
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=94.15  E-value=0.88  Score=55.96  Aligned_cols=27  Identities=15%  Similarity=0.361  Sum_probs=19.4

Q ss_pred             CCCCcccccccccCCCCCcccccccccc
Q 000153          449 PWNNSVHSFNSQRAERNPWEQYGSEQYN  476 (2021)
Q Consensus       449 Pw~~~msSys~R~~eRt~dE~yg~~qy~  476 (2021)
                      .|+...+.|..+..||... .|+..+-+
T Consensus       188 dwndvladyea~eswrent-a~gdi~ee  214 (672)
T KOG4722|consen  188 DWNDVLADYEAEESWRENT-AQGDIHEE  214 (672)
T ss_pred             chhhHHHHHHHHHHHHhcc-hhhhhhcc
Confidence            4888899999999999333 56655433


No 34 
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=93.92  E-value=0.88  Score=58.03  Aligned_cols=6  Identities=33%  Similarity=0.130  Sum_probs=2.9

Q ss_pred             Cccccc
Q 000153          780 SSTFIT  785 (2021)
Q Consensus       780 SSsF~P  785 (2021)
                      -|+|-|
T Consensus       249 ls~fdp  254 (514)
T TIGR03319       249 LSGFDP  254 (514)
T ss_pred             ecCCch
Confidence            455544


No 35 
>PRK00106 hypothetical protein; Provisional
Probab=93.84  E-value=0.82  Score=58.59  Aligned_cols=6  Identities=33%  Similarity=0.130  Sum_probs=2.7

Q ss_pred             Cccccc
Q 000153          780 SSTFIT  785 (2021)
Q Consensus       780 SSsF~P  785 (2021)
                      -|+|-|
T Consensus       270 lS~fdp  275 (535)
T PRK00106        270 LSGFDP  275 (535)
T ss_pred             EeCCCh
Confidence            444543


No 36 
>PF00769 ERM:  Ezrin/radixin/moesin family;  InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []. Ezrin was first identified as a constituent of microvilli [], radixin as a barbed, end-capping actin-modulating protein from isolated junctional fractions [], and moesin as a heparin binding protein []. A tumour suppressor molecule responsible for neurofibromatosis type 2 (NF2) is highly similar to ERM proteins and has been designated merlin (moesin-ezrin-radixin-like protein). ERM molecules contain 3 domains, an N-terminal globular domain; an extended alpha-helical domain; and a charged C-terminal domain []. Ezrin, radixin and merlin also contain a polyproline region between the helical and C-terminal domains. The N-terminal domain is highly conserved, and is also found in merlin, band 4.1 proteins and members of the band 4.1 superfamily. ERM proteins crosslink actin filaments with plasma membranes. They co-localise with CD44 at actin filament-plasma membrane interaction sites, associating with CD44 via their N-terminal domains and with actin filaments via their C-terminal domains [].; GO: 0008092 cytoskeletal protein binding, 0005737 cytoplasm, 0019898 extrinsic to membrane; PDB: 2I1J_A 2I1K_A 1E5W_A 1EF1_C.
Probab=93.63  E-value=3.4  Score=48.41  Aligned_cols=15  Identities=40%  Similarity=0.492  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHHHHH
Q 000153          574 ELERVQKMQEQERQR  588 (2021)
Q Consensus       574 ELERreKeqEEERKR  588 (2021)
                      +++++....+++.++
T Consensus         9 Ele~rL~q~eee~~~   23 (246)
T PF00769_consen    9 ELEERLRQMEEEMRR   23 (246)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344443434444333


No 37 
>PRK00106 hypothetical protein; Provisional
Probab=93.30  E-value=5.5  Score=51.44  Aligned_cols=7  Identities=43%  Similarity=0.947  Sum_probs=2.9

Q ss_pred             CCccccc
Q 000153          767 FNSWRRD  773 (2021)
Q Consensus       767 ~nswrR~  773 (2021)
                      ||-.||.
T Consensus       273 fdpvRRe  279 (535)
T PRK00106        273 FDPIRRE  279 (535)
T ss_pred             CChHHHH
Confidence            3344444


No 38 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=93.15  E-value=2.2  Score=56.34  Aligned_cols=9  Identities=22%  Similarity=0.187  Sum_probs=3.5

Q ss_pred             ccccccccc
Q 000153          174 PAEKASVLR  182 (2021)
Q Consensus       174 ~~e~~~vlr  182 (2021)
                      -+|-++.||
T Consensus       132 ~~e~~~~~~  140 (697)
T PF09726_consen  132 YVEASVRLK  140 (697)
T ss_pred             HHHHHHhhc
Confidence            344333333


No 39 
>PRK12705 hypothetical protein; Provisional
Probab=90.85  E-value=7.5  Score=50.00  Aligned_cols=13  Identities=38%  Similarity=0.560  Sum_probs=6.9

Q ss_pred             hhhhhhhhhhhcc
Q 000153          547 LVGVVKKKKDVLK  559 (2021)
Q Consensus       547 lisaIKKKKEelk  559 (2021)
                      ++.++++++...+
T Consensus        21 ~~~~~~~~~~~~~   33 (508)
T PRK12705         21 LVVLLKKRQRLAK   33 (508)
T ss_pred             HHHHHHHHHHHHH
Confidence            4456666654433


No 40 
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=89.24  E-value=15  Score=46.30  Aligned_cols=6  Identities=33%  Similarity=0.440  Sum_probs=2.9

Q ss_pred             cccCCC
Q 000153          787 DAENGH  792 (2021)
Q Consensus       787 d~ENg~  792 (2021)
                      ||.||.
T Consensus       358 dhG~gy  363 (420)
T COG4942         358 DHGGGY  363 (420)
T ss_pred             EcCCcc
Confidence            444443


No 41 
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=88.65  E-value=5.3  Score=48.71  Aligned_cols=42  Identities=21%  Similarity=0.130  Sum_probs=23.4

Q ss_pred             ccccccccccccccCCccccccCCCCCchhhhcccccccCccCCCcceeeccC
Q 000153          959 ISLAGLDRSEQHNLAQPEIIDVQPESTENEEQNLERSTTSRCDSQSSLSVSSA 1011 (2021)
Q Consensus       959 t~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~r~~t~~~~sqsslsvssp 1011 (2021)
                      ..-++|.++||+...|.-       ++  -.|++-  ++.-.|-|+|.-.|+|
T Consensus       450 aSSp~~qssyqvginqrf-------ha--aRhkf~--aqad~dqqasgl~sp~  491 (561)
T KOG1103|consen  450 ASSPAVQSSYQVGINQRF-------HA--ARHKFA--AQADMDQQASGLNSPA  491 (561)
T ss_pred             cCChhhhhhhhhcchhhh-------hh--ccchhh--hcccCcccccccCCCc
Confidence            344678888887544422       11  123343  4666777777665544


No 42 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=88.62  E-value=2.4  Score=53.49  Aligned_cols=20  Identities=25%  Similarity=0.275  Sum_probs=12.6

Q ss_pred             hhhcccchhHhhhccccccc
Q 000153          201 KKQKDGFSQKQKQGMSQELG  220 (2021)
Q Consensus       201 ~k~~~~~~qk~k~~~~~~~~  220 (2021)
                      +|.-+.+.-||+|.|+.--+
T Consensus       115 kkkmea~fakqrqklgksaf  134 (708)
T KOG3654|consen  115 KKKMEAIFAKQRQKLGKSAF  134 (708)
T ss_pred             HHHHHHHHHHHHHHhchhhe
Confidence            34445566678877776555


No 43 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=87.21  E-value=12  Score=49.19  Aligned_cols=8  Identities=13%  Similarity=0.401  Sum_probs=3.5

Q ss_pred             CCCcCCcc
Q 000153          347 RDSETGKV  354 (2021)
Q Consensus       347 r~~e~~k~  354 (2021)
                      |.|+.++|
T Consensus       575 ~~~~~~~~  582 (1187)
T KOG0579|consen  575 RANAVSNI  582 (1187)
T ss_pred             hhhhhhhh
Confidence            44444444


No 44 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=85.71  E-value=33  Score=45.36  Aligned_cols=11  Identities=36%  Similarity=0.413  Sum_probs=5.0

Q ss_pred             CCCCccccccc
Q 000153          183 GEDFPSLQAAL  193 (2021)
Q Consensus       183 gedfpsl~a~~  193 (2021)
                      |+-|-++|++.
T Consensus       473 G~~~~s~qs~~  483 (1187)
T KOG0579|consen  473 GSTFFSPQSSA  483 (1187)
T ss_pred             CccccCccccC
Confidence            44444444444


No 45 
>PF02029 Caldesmon:  Caldesmon;  InterPro: IPR006018  This group of proteins includes two protein families: caldesmon and lymphocyte specific protein.  Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart). 
Probab=85.37  E-value=3.2  Score=52.92  Aligned_cols=15  Identities=20%  Similarity=0.339  Sum_probs=8.2

Q ss_pred             cccCCCCCCCCCCCC
Q 000153          875 GWGQGRYRGNVHPPY  889 (2021)
Q Consensus       875 gW~~ssS~~rp~PP~  889 (2021)
                      -|+...+.++..|.+
T Consensus       459 ~w~~~~~e~~~~~~~  473 (492)
T PF02029_consen  459 QWLTKTPEGSKSPAP  473 (492)
T ss_pred             HhhcCCCCCCCCCCC
Confidence            466666665554433


No 46 
>PF12128 DUF3584:  Protein of unknown function (DUF3584);  InterPro: IPR021979  This family consist of uncharacterised bacterial proteins. 
Probab=85.12  E-value=18  Score=50.81  Aligned_cols=7  Identities=43%  Similarity=0.648  Sum_probs=2.8

Q ss_pred             hhccccc
Q 000153         1228 LMDHLNA 1234 (2021)
Q Consensus      1228 ~~~~~~a 1234 (2021)
                      +++-|+.
T Consensus      1167 l~~~~~~ 1173 (1201)
T PF12128_consen 1167 LLDMCNS 1173 (1201)
T ss_pred             HHHHHHh
Confidence            3333443


No 47 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=84.84  E-value=27  Score=47.19  Aligned_cols=11  Identities=27%  Similarity=0.570  Sum_probs=6.2

Q ss_pred             CCcccccCCCC
Q 000153          841 GQRWNMSGDGD  851 (2021)
Q Consensus       841 p~~W~apgDGd  851 (2021)
                      ...|-+||-|.
T Consensus       734 ~~v~IIHGkGt  744 (782)
T PRK00409        734 GEVLIIHGKGT  744 (782)
T ss_pred             CEEEEEcCCCh
Confidence            34555666664


No 48 
>KOG3634 consensus Troponin [Cytoskeleton]
Probab=84.15  E-value=12  Score=45.89  Aligned_cols=9  Identities=33%  Similarity=0.331  Sum_probs=4.2

Q ss_pred             hhhhhhhhc
Q 000153          721 DGERMVERI  729 (2021)
Q Consensus       721 D~ERmVERI  729 (2021)
                      |+..+.+||
T Consensus       266 DlkeL~eRq  274 (361)
T KOG3634|consen  266 DLKELNERQ  274 (361)
T ss_pred             cHHHHHHHH
Confidence            444445554


No 49 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=84.08  E-value=25  Score=47.41  Aligned_cols=13  Identities=23%  Similarity=0.664  Sum_probs=7.0

Q ss_pred             cCCCCCCeeecCC
Q 000153          277 YFPGPLPLVRLKP  289 (2021)
Q Consensus       277 ~~~gplplvrl~~  289 (2021)
                      +|.-|..+|-||-
T Consensus       217 ~~~ep~~~~~ln~  229 (771)
T TIGR01069       217 FYIEPQAIVKLNN  229 (771)
T ss_pred             EEEEcHHHHHHHH
Confidence            4555555665553


No 50 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=83.74  E-value=24  Score=47.63  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=5.8

Q ss_pred             cCCCCCCeeecC
Q 000153          277 YFPGPLPLVRLK  288 (2021)
Q Consensus       277 ~~~gplplvrl~  288 (2021)
                      +|.-|..+|-||
T Consensus       222 ~y~ep~~~~~ln  233 (782)
T PRK00409        222 LYIEPQSVVELN  233 (782)
T ss_pred             EEEEcHHHHHHH
Confidence            444455455444


No 51 
>PF09731 Mitofilin:  Mitochondrial inner membrane protein;  InterPro: IPR019133  Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=83.00  E-value=81  Score=40.93  Aligned_cols=7  Identities=14%  Similarity=0.245  Sum_probs=3.0

Q ss_pred             cccCCCC
Q 000153          319 YWEGDFD  325 (2021)
Q Consensus       319 ~w~~~fd  325 (2021)
                      ||++.|+
T Consensus        27 ~~n~~f~   33 (582)
T PF09731_consen   27 KQNDNFR   33 (582)
T ss_pred             hcChHHH
Confidence            4444443


No 52 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=82.35  E-value=31  Score=46.59  Aligned_cols=8  Identities=25%  Similarity=0.439  Sum_probs=4.0

Q ss_pred             cccccCCC
Q 000153          843 RWNMSGDG  850 (2021)
Q Consensus       843 ~W~apgDG  850 (2021)
                      .+=+||-|
T Consensus       725 v~IIHGkG  732 (771)
T TIGR01069       725 VLIIHGKG  732 (771)
T ss_pred             EEEEcCCC
Confidence            34455555


No 53 
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=82.16  E-value=54  Score=44.76  Aligned_cols=15  Identities=40%  Similarity=0.724  Sum_probs=8.0

Q ss_pred             ccccCC-CCCCCCCCCC
Q 000153          318 AYWEGD-FDMPRPSVLP  333 (2021)
Q Consensus       318 ~~w~~~-fd~~~~~~~p  333 (2021)
                      +-|+++ |.| +--|||
T Consensus       752 pvy~eepfvF-~KVvLp  767 (1189)
T KOG1265|consen  752 PVYEEEPFVF-RKVVLP  767 (1189)
T ss_pred             cccccCCccc-ceeccc
Confidence            446554 444 444677


No 54 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=82.01  E-value=7.8  Score=50.41  Aligned_cols=10  Identities=0%  Similarity=-0.409  Sum_probs=5.3

Q ss_pred             CcccccCccc
Q 000153          816 GIMSSRNYYK  825 (2021)
Q Consensus       816 gFvsK~PY~~  825 (2021)
                      .|+|-.|-..
T Consensus       185 t~vklqP~~~  194 (567)
T PLN03086        185 TYAKLQPDGV  194 (567)
T ss_pred             CEEEEeeccC
Confidence            4555555544


No 55 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=80.81  E-value=53  Score=48.43  Aligned_cols=12  Identities=42%  Similarity=1.096  Sum_probs=7.1

Q ss_pred             CCCCCCCCCCCC
Q 000153          498 RGFPHNDPMHNF  509 (2021)
Q Consensus       498 kG~~~ndP~~nF  509 (2021)
                      +|||.+=+...|
T Consensus       699 ~GfPnr~~~~eF  710 (1930)
T KOG0161|consen  699 QGFPNRMPFQEF  710 (1930)
T ss_pred             hhCccccchHHH
Confidence            566666555555


No 56 
>PTZ00491 major vault protein; Provisional
Probab=80.77  E-value=37  Score=46.20  Aligned_cols=10  Identities=30%  Similarity=0.604  Sum_probs=5.7

Q ss_pred             CCcccccCCC
Q 000153          150 DGVGVYVPPS  159 (2021)
Q Consensus       150 ~~~~~~~~~s  159 (2021)
                      ++.|.|+|..
T Consensus       198 t~~gaylP~v  207 (850)
T PTZ00491        198 RTPGAYLPGV  207 (850)
T ss_pred             eccccccCCC
Confidence            4466666654


No 57 
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=80.60  E-value=59  Score=40.30  Aligned_cols=10  Identities=30%  Similarity=0.584  Sum_probs=5.0

Q ss_pred             CCCCCCCCCC
Q 000153          500 FPHNDPMHNF  509 (2021)
Q Consensus       500 ~~~ndP~~nF  509 (2021)
                      +++|||....
T Consensus        55 ~NinDP~~AL   64 (561)
T KOG1103|consen   55 LNINDPFAAL   64 (561)
T ss_pred             cccCChHHHH
Confidence            4555555443


No 58 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=80.02  E-value=11  Score=47.85  Aligned_cols=17  Identities=24%  Similarity=0.235  Sum_probs=9.7

Q ss_pred             CCCCCCCcccccccccC
Q 000153           75 PPPLNLPSLRKEHERFD   91 (2021)
Q Consensus        75 p~plnlpslrkeh~~~d   91 (2021)
                      +.||---+-.++||--|
T Consensus        17 s~~l~ed~~~~~~ed~d   33 (708)
T KOG3654|consen   17 SKPLSEDPTKAPVEDPD   33 (708)
T ss_pred             CcccccccccCCcCCCc
Confidence            44555445556676665


No 59 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=79.80  E-value=14  Score=44.31  Aligned_cols=6  Identities=33%  Similarity=0.628  Sum_probs=2.3

Q ss_pred             CCCCCC
Q 000153          803 GRAVPR  808 (2021)
Q Consensus       803 grsppr  808 (2021)
                      +++||+
T Consensus       254 ~t~fPR  259 (290)
T KOG2689|consen  254 HTGFPR  259 (290)
T ss_pred             ecCCCc
Confidence            333444


No 60 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=79.59  E-value=4.4  Score=50.70  Aligned_cols=8  Identities=50%  Similarity=0.567  Sum_probs=3.8

Q ss_pred             ccccccCC
Q 000153          907 RSRYSMRH  914 (2021)
Q Consensus       907 r~rys~rq  914 (2021)
                      |+|--|+.
T Consensus       464 rsr~~~~R  471 (506)
T KOG2507|consen  464 RSRRRMPR  471 (506)
T ss_pred             hhhhcCcC
Confidence            55554433


No 61 
>PF06098 Radial_spoke_3:  Radial spoke protein 3;  InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=78.91  E-value=18  Score=43.95  Aligned_cols=15  Identities=13%  Similarity=0.209  Sum_probs=10.5

Q ss_pred             CCCcccccccCCCCC
Q 000153          335 KPAHNVFERWGQRDS  349 (2021)
Q Consensus       335 k~~~~~~~~~gqr~~  349 (2021)
                      .|++-|||++=-|||
T Consensus         2 ~~~NiM~D~RV~RGn   16 (291)
T PF06098_consen    2 TYGNIMYDRRVVRGN   16 (291)
T ss_pred             CcccccCCCCcCCCC
Confidence            467788887765555


No 62 
>KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms]
Probab=77.11  E-value=1.5e+02  Score=34.67  Aligned_cols=11  Identities=27%  Similarity=0.782  Sum_probs=5.3

Q ss_pred             ccccccccccc
Q 000153          469 QYGSEQYNRFR  479 (2021)
Q Consensus       469 ~yg~~qy~rYr  479 (2021)
                      +|--.+|.+|+
T Consensus        71 ~y~r~~FgrYG   81 (225)
T KOG4848|consen   71 AYRRERFGRYG   81 (225)
T ss_pred             HHHHHHHHhhc
Confidence            44444455554


No 63 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=76.49  E-value=62  Score=40.72  Aligned_cols=10  Identities=40%  Similarity=0.461  Sum_probs=3.8

Q ss_pred             hhhhhhcccc
Q 000153          723 ERMVERITTS  732 (2021)
Q Consensus       723 ERmVERI~TS  732 (2021)
                      |.---||..|
T Consensus       419 eefkrriles  428 (442)
T PF06637_consen  419 EEFKRRILES  428 (442)
T ss_pred             HHHHHHHHhc
Confidence            3333344333


No 64 
>PLN02316 synthase/transferase
Probab=76.44  E-value=30  Score=48.17  Aligned_cols=24  Identities=17%  Similarity=0.267  Sum_probs=12.6

Q ss_pred             CccccccccCCC--CcccccCcccCC
Q 000153          768 NSWRRDAFESGN--SSTFITQDAENG  791 (2021)
Q Consensus       768 nswrR~~~~rd~--SSsF~Pqd~ENg  791 (2021)
                      +.|-+-.|-|+.  .+.|.|+.+.+.
T Consensus       509 ev~~~g~~NrWth~~~~~~~~~m~~~  534 (1036)
T PLN02316        509 EVWFRGSFNRWTHRLGPLPPQKMVPA  534 (1036)
T ss_pred             eEEEEccccCcCCCCCCCCceeeeec
Confidence            344444454444  345777766554


No 65 
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=75.07  E-value=2.2e+02  Score=36.77  Aligned_cols=12  Identities=17%  Similarity=0.318  Sum_probs=6.3

Q ss_pred             hhhhhhhhhccc
Q 000153          549 GVVKKKKDVLKQ  560 (2021)
Q Consensus       549 saIKKKKEelkq  560 (2021)
                      .++++|..++..
T Consensus       225 ~flerkv~eled  236 (502)
T KOG0982|consen  225 RFLERKVQELED  236 (502)
T ss_pred             HHHHHHHHHhhc
Confidence            445666555443


No 66 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=74.60  E-value=1.1e+02  Score=42.99  Aligned_cols=63  Identities=25%  Similarity=0.293  Sum_probs=33.5

Q ss_pred             cCCCCCCccCCCcccccccccCCCCccccccccCCCCchh--hhcccch---hHhhhcccccccccccCCCCCCC
Q 000153          162 SGTVGPALSSFAPAEKASVLRGEDFPSLQAALPAASGSEK--KQKDGFS---QKQKQGMSQELGNNEQKDGCRFN  231 (2021)
Q Consensus       162 ~~~~~~~~~~~~~~e~~~vlrgedfpsl~a~~p~~~~~~~--k~~~~~~---qk~k~~~~~~~~~~e~~~~~~~~  231 (2021)
                      +|.++|-...|..+|+-+       --+|+.|-+++++..  ++-...-   .||-|.+-+.|..-|.+-.+-.+
T Consensus      1193 tGv~gay~s~f~~me~kl-------~~ir~il~~~svs~~~i~~l~~~~~~lr~~l~~~~e~L~~~E~~Lsdi~~ 1260 (1758)
T KOG0994|consen 1193 TGVLGAYASRFLDMEEKL-------EEIRAILSAPSVSAEDIAQLASATESLRRQLQALTEDLPQEEETLSDITN 1260 (1758)
T ss_pred             ccCchhhHhHHHHHHHHH-------HHHHHHhcCCCccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhh
Confidence            566666555555554322       124556655555554  2222222   37777777777766665554443


No 67 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=73.23  E-value=29  Score=41.96  Aligned_cols=12  Identities=8%  Similarity=0.002  Sum_probs=5.4

Q ss_pred             ccCCCCCccccc
Q 000153          810 EFYGGPGIMSSR  821 (2021)
Q Consensus       810 efyggagFvsK~  821 (2021)
                      +|....+|+++-
T Consensus       250 P~~f~t~fPR~t  261 (290)
T KOG2689|consen  250 PYSFHTGFPRVT  261 (290)
T ss_pred             CeeeecCCCcee
Confidence            344444444443


No 68 
>KOG3634 consensus Troponin [Cytoskeleton]
Probab=73.20  E-value=26  Score=43.20  Aligned_cols=7  Identities=43%  Similarity=0.610  Sum_probs=2.8

Q ss_pred             HHHHHHH
Q 000153          679 IAKRQAE  685 (2021)
Q Consensus       679 eKKeEaE  685 (2021)
                      .-+++.+
T Consensus       204 mtKeQqE  210 (361)
T KOG3634|consen  204 MTKEQQE  210 (361)
T ss_pred             ccHHHHH
Confidence            3344444


No 69 
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=72.61  E-value=23  Score=45.99  Aligned_cols=6  Identities=33%  Similarity=0.850  Sum_probs=2.8

Q ss_pred             cccccc
Q 000153          469 QYGSEQ  474 (2021)
Q Consensus       469 ~yg~~q  474 (2021)
                      .||++.
T Consensus       149 ~yGIDs  154 (645)
T KOG0681|consen  149 AYGIDS  154 (645)
T ss_pred             eechhh
Confidence            345544


No 70 
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=71.45  E-value=1.7e+02  Score=40.41  Aligned_cols=10  Identities=20%  Similarity=0.471  Sum_probs=4.4

Q ss_pred             CCCCCCcccc
Q 000153          399 GDNRNGICER  408 (2021)
Q Consensus       399 gneR~GigvR  408 (2021)
                      .+++-.||+|
T Consensus       795 ~~GYrhv~LR  804 (1189)
T KOG1265|consen  795 NAGYRHVCLR  804 (1189)
T ss_pred             cCcceeEEec
Confidence            3344444444


No 71 
>PTZ00491 major vault protein; Provisional
Probab=71.14  E-value=93  Score=42.68  Aligned_cols=9  Identities=44%  Similarity=0.936  Sum_probs=4.9

Q ss_pred             CCcccccCC
Q 000153          150 DGVGVYVPP  158 (2021)
Q Consensus       150 ~~~~~~~~~  158 (2021)
                      .++|.|.|-
T Consensus       145 ~gPGtYlPr  153 (850)
T PTZ00491        145 KGPGTYYPR  153 (850)
T ss_pred             ECCeeecCC
Confidence            445566654


No 72 
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=70.20  E-value=25  Score=45.02  Aligned_cols=11  Identities=27%  Similarity=0.495  Sum_probs=5.8

Q ss_pred             CCCcccccccC
Q 000153          291 SDWADDERDTG  301 (2021)
Q Consensus       291 sdwadderdt~  301 (2021)
                      ..|-+|..+-.
T Consensus        63 ~~~r~~~~~~~   73 (460)
T KOG1363|consen   63 FNYRDDNVDVS   73 (460)
T ss_pred             hcccccCCCcc
Confidence            55655555433


No 73 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=69.92  E-value=1.4e+02  Score=44.40  Aligned_cols=9  Identities=22%  Similarity=0.298  Sum_probs=4.8

Q ss_pred             CCccccccc
Q 000153          185 DFPSLQAAL  193 (2021)
Q Consensus       185 dfpsl~a~~  193 (2021)
                      ||.-|....
T Consensus       302 ~Y~f~~~~~  310 (1930)
T KOG0161|consen  302 DYKFLSNGE  310 (1930)
T ss_pred             hhhhhcccc
Confidence            555555544


No 74 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=69.57  E-value=87  Score=43.95  Aligned_cols=11  Identities=27%  Similarity=0.344  Sum_probs=5.5

Q ss_pred             CCceEEeeccC
Q 000153           52 GGGMLVLSRPR   62 (2021)
Q Consensus        52 ~ggm~vlsr~r   62 (2021)
                      +=||+++.+.|
T Consensus       645 ~c~~~~~~dd~  655 (1758)
T KOG0994|consen  645 RCGMAIPKDDR  655 (1758)
T ss_pred             ccccccccccc
Confidence            44555555443


No 75 
>COG2433 Uncharacterized conserved protein [Function unknown]
Probab=69.53  E-value=1e+02  Score=40.93  Aligned_cols=12  Identities=8%  Similarity=0.086  Sum_probs=6.2

Q ss_pred             cccccccccCCC
Q 000153          453 SVHSFNSQRAER  464 (2021)
Q Consensus       453 ~msSys~R~~eR  464 (2021)
                      .++-++.++..+
T Consensus       266 vl~~~S~r~~~~  277 (652)
T COG2433         266 VLDLESRRGIDR  277 (652)
T ss_pred             EEeeeccccCCH
Confidence            444455555554


No 76 
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=68.46  E-value=34  Score=42.92  Aligned_cols=49  Identities=22%  Similarity=0.291  Sum_probs=27.0

Q ss_pred             cccCCCCCCCCCCccCCCCcccccCCCCCccccCCCCCCccccccccCCC-Cccccc
Q 000153          730 TTSASSDSSGLHRSFDMSSRNQFARDNSSGFLDRGKPFNSWRRDAFESGN-SSTFIT  785 (2021)
Q Consensus       730 ~TSSSsDSs~~NR~~e~VaRI~TSRDidSpfldR~K~~nswrR~~~~rd~-SSsF~P  785 (2021)
                      +.+-+.++....|++      +-..+.+|.|.++ ..||..-.+-+.-.. ++.|-|
T Consensus       395 ~~~~~~e~qyDqRlF------nq~~g~dSg~~~d-d~ynvYD~~wr~~q~~~siYrp  444 (506)
T KOG2441|consen  395 KPSESGEVQYDQRLF------NQGKGLDSGFADD-DEYNVYDKPWRGAQDISSIYRP  444 (506)
T ss_pred             CCCCCCcchhhHHhh------hcccCcccccccc-ccccccccccccCCchhhhhCC
Confidence            446667777777773      2335666777666 455554444333333 555544


No 77 
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=67.65  E-value=2.6e+02  Score=36.16  Aligned_cols=15  Identities=20%  Similarity=0.122  Sum_probs=7.3

Q ss_pred             cCCCCCCCCCCCCCC
Q 000153          492 SFSSGGRGFPHNDPM  506 (2021)
Q Consensus       492 sfslGgkG~~~ndP~  506 (2021)
                      .-+++.+.+..|.|.
T Consensus       170 ~ls~~~~a~~snspt  184 (502)
T KOG0982|consen  170 LLSVKKDAERSNSPT  184 (502)
T ss_pred             hccccchhhccCchh
Confidence            344455555555444


No 78 
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=66.62  E-value=2.8e+02  Score=35.75  Aligned_cols=21  Identities=19%  Similarity=0.137  Sum_probs=11.0

Q ss_pred             hhhhhhccccCCCCCCCCCCc
Q 000153          723 ERMVERITTSASSDSSGLHRS  743 (2021)
Q Consensus       723 ERmVERI~TSSSsDSs~~NR~  743 (2021)
                      +-+|+.-..|......+-++.
T Consensus       156 d~~v~~~lpS~~~~~ld~h~g  176 (459)
T KOG0288|consen  156 DHFVEDTLPSRALFVLDAHEG  176 (459)
T ss_pred             chhhhcccchhhhhhhhcccc
Confidence            445555455555555555544


No 79 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=66.56  E-value=1.4e+02  Score=38.23  Aligned_cols=7  Identities=43%  Similarity=1.099  Sum_probs=3.1

Q ss_pred             CCccccc
Q 000153          841 GQRWNMS  847 (2021)
Q Consensus       841 p~~W~ap  847 (2021)
                      ..+|-.+
T Consensus       258 ~~rws~~  264 (445)
T PRK13428        258 SQRWSAN  264 (445)
T ss_pred             hCccCcc
Confidence            4444444


No 80 
>KOG3756 consensus Pinin (desmosome-associated protein) [Cytoskeleton]
Probab=64.75  E-value=3.6e+02  Score=33.70  Aligned_cols=6  Identities=0%  Similarity=-0.324  Sum_probs=2.3

Q ss_pred             cccccc
Q 000153          381 MWRASS  386 (2021)
Q Consensus       381 ~Wr~ss  386 (2021)
                      +|+.+.
T Consensus        58 ~~~lr~   63 (340)
T KOG3756|consen   58 SLLLRR   63 (340)
T ss_pred             hhhhhh
Confidence            343333


No 81 
>PRK04863 mukB cell division protein MukB; Provisional
Probab=64.04  E-value=2.6e+02  Score=41.03  Aligned_cols=11  Identities=9%  Similarity=0.289  Sum_probs=6.1

Q ss_pred             CCCCCCCCcee
Q 000153         1288 SLIPSPFPAIQ 1298 (2021)
Q Consensus      1288 slipspvpaiq 1298 (2021)
                      .+.|.|-|+|+
T Consensus       830 ~f~~~pe~~~~  840 (1486)
T PRK04863        830 AFEADPEAELR  840 (1486)
T ss_pred             hcCCCcHHHHH
Confidence            34556666654


No 82 
>PF10168 Nup88:  Nuclear pore component;  InterPro: IPR019321  Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells []. 
Probab=63.78  E-value=1.7e+02  Score=39.86  Aligned_cols=15  Identities=20%  Similarity=0.441  Sum_probs=7.2

Q ss_pred             CcccccccccCCCCC
Q 000153           81 PSLRKEHERFDSSGS   95 (2021)
Q Consensus        81 pslrkeh~~~d~~~~   95 (2021)
                      |-+--.|-.+-+.|.
T Consensus        83 ~~f~v~~i~~n~~g~   97 (717)
T PF10168_consen   83 PLFEVHQISLNPTGS   97 (717)
T ss_pred             CceeEEEEEECCCCC
Confidence            445555555544443


No 83 
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=62.97  E-value=3.6e+02  Score=38.10  Aligned_cols=18  Identities=22%  Similarity=0.219  Sum_probs=8.1

Q ss_pred             CCCCCCcccchhhhhhhh
Q 000153          537 FDGRDPFSAGLVGVVKKK  554 (2021)
Q Consensus       537 fDG~Dpf~~~lisaIKKK  554 (2021)
                      .+|..++...++..+.+-
T Consensus       662 TGGs~~~~a~~L~~l~~l  679 (1174)
T KOG0933|consen  662 TGGSRSKGADLLRQLQKL  679 (1174)
T ss_pred             cCCCCCCcccHHHHHHHH
Confidence            444545544444444443


No 84 
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=62.64  E-value=44  Score=43.64  Aligned_cols=6  Identities=33%  Similarity=0.794  Sum_probs=3.1

Q ss_pred             CCCeee
Q 000153          281 PLPLVR  286 (2021)
Q Consensus       281 plplvr  286 (2021)
                      +.|||-
T Consensus        23 ~~piVI   28 (645)
T KOG0681|consen   23 TIPIVI   28 (645)
T ss_pred             CCcEEE
Confidence            455554


No 85 
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]
Probab=62.52  E-value=1.4e+02  Score=40.54  Aligned_cols=15  Identities=33%  Similarity=0.410  Sum_probs=9.3

Q ss_pred             CCccccCCCCCCCccc
Q 000153           69 VPKLSVPPPLNLPSLR   84 (2021)
Q Consensus        69 ~~klsvp~plnlpslr   84 (2021)
                      --|-|--.|+| |-++
T Consensus       229 elkrSTel~in-PD~~  243 (1424)
T KOG4572|consen  229 ELKRSTELPIN-PDEK  243 (1424)
T ss_pred             hhccccccCCC-CCCc
Confidence            55666666777 5554


No 86 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=62.01  E-value=13  Score=50.23  Aligned_cols=25  Identities=44%  Similarity=0.570  Sum_probs=12.0

Q ss_pred             CCCCCCCC----CCCCCCCCCCceEEeec
Q 000153           36 HSGYYGSN----RARPTGGGGGGMLVLSR   60 (2021)
Q Consensus        36 ~~g~~~~~----~~~~~~~~~ggm~vlsr   60 (2021)
                      ++|+||.+    ++++|.|.|||.-=.||
T Consensus      1204 gsGGYGgsa~~~~~~~Gagvg~GyrGvsr 1232 (1282)
T KOG0921|consen 1204 GSGGYGGSAPSARANYGAGVGNGYRGVSR 1232 (1282)
T ss_pred             CCCCCCCCCCCCCCCccccccCCCccccC
Confidence            44555443    24445555666633333


No 87 
>KOG2668 consensus Flotillins [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=61.59  E-value=3.4e+02  Score=34.47  Aligned_cols=8  Identities=13%  Similarity=0.181  Sum_probs=2.9

Q ss_pred             CCccCCCC
Q 000153          741 HRSFDMSS  748 (2021)
Q Consensus       741 NR~~e~Va  748 (2021)
                      ++.+.+.+
T Consensus       398 ~~l~~~LP  405 (428)
T KOG2668|consen  398 AGLYKMLP  405 (428)
T ss_pred             HHHHHhCc
Confidence            33333333


No 88 
>PRK04863 mukB cell division protein MukB; Provisional
Probab=61.03  E-value=2.5e+02  Score=41.27  Aligned_cols=37  Identities=14%  Similarity=0.395  Sum_probs=15.6

Q ss_pred             ccC-CcccccCCCCccccccccCc-ccccccccccCCccc
Q 000153          839 SRG-QRWNMSGDGDHYGRNIEMES-DFHENITERYGDVGW  876 (2021)
Q Consensus       839 ~~p-~~W~apgDGd~igRq~E~dS-d~~~n~~erfGdsgW  876 (2021)
                      +|| ++.-+.+|-+-+.-. .|+. .|+.-+.-+|++.-|
T Consensus       730 ~~p~d~~li~~~~~~~~~~-~~~~~~~~~~v~~~~~~~~~  768 (1486)
T PRK04863        730 DCPEDLYLIEGDPDSFDDS-VFSVEELEKAVVVKIADRQW  768 (1486)
T ss_pred             CCccceeeecCChhHHhcc-CccHHHhcCCeeeeecchhh
Confidence            354 555554444433222 2222 222333445565555


No 89 
>PRK12472 hypothetical protein; Provisional
Probab=60.80  E-value=1.1e+02  Score=39.89  Aligned_cols=8  Identities=13%  Similarity=-0.192  Sum_probs=3.9

Q ss_pred             CCccCCCC
Q 000153          515 PLLKREEP  522 (2021)
Q Consensus       515 s~~KsEKP  522 (2021)
                      +++|-.-|
T Consensus       136 SHGCVRLp  143 (508)
T PRK12472        136 SHGCVRMP  143 (508)
T ss_pred             CCcccCCC
Confidence            55554443


No 90 
>PF05914 RIB43A:  RIB43A;  InterPro: IPR008805 This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [].
Probab=60.75  E-value=4.5e+02  Score=33.45  Aligned_cols=14  Identities=14%  Similarity=0.214  Sum_probs=5.7

Q ss_pred             CCcccchhhhhhhh
Q 000153          541 DPFSAGLVGVVKKK  554 (2021)
Q Consensus       541 Dpf~~~lisaIKKK  554 (2021)
                      -.|.+..+....++
T Consensus       140 Q~F~GEDl~~~~R~  153 (379)
T PF05914_consen  140 QKFDGEDLNREERK  153 (379)
T ss_pred             cccccccCCHHHHH
Confidence            33444444443333


No 91 
>PF10168 Nup88:  Nuclear pore component;  InterPro: IPR019321  Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells []. 
Probab=60.40  E-value=3.9e+02  Score=36.55  Aligned_cols=9  Identities=33%  Similarity=1.147  Sum_probs=4.1

Q ss_pred             CCCCccccc
Q 000153          449 PWNNSVHSF  457 (2021)
Q Consensus       449 Pw~~~msSy  457 (2021)
                      +|...+..|
T Consensus       395 ~wl~~L~~f  403 (717)
T PF10168_consen  395 PWLSALQEF  403 (717)
T ss_pred             ccHHHHHHH
Confidence            354444444


No 92 
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=58.12  E-value=3.3e+02  Score=39.64  Aligned_cols=6  Identities=50%  Similarity=1.049  Sum_probs=3.1

Q ss_pred             ccCCCC
Q 000153          361 RVDPFG  366 (2021)
Q Consensus       361 ~~~~~~  366 (2021)
                      .+|||+
T Consensus        57 rln~~~   62 (1353)
T TIGR02680        57 RLEPDG   62 (1353)
T ss_pred             ccCCCC
Confidence            445555


No 93 
>PRK12472 hypothetical protein; Provisional
Probab=57.10  E-value=1.9e+02  Score=37.79  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=3.9

Q ss_pred             cccccCCCC
Q 000153          908 SRYSMRHPR  916 (2021)
Q Consensus       908 ~rys~rqpr  916 (2021)
                      .||.-+||.
T Consensus       480 ~~~~~~~~~  488 (508)
T PRK12472        480 QRYPKPQPA  488 (508)
T ss_pred             ccCCCCCCC
Confidence            344444443


No 94 
>COG2433 Uncharacterized conserved protein [Function unknown]
Probab=56.83  E-value=1.1e+02  Score=40.62  Aligned_cols=6  Identities=50%  Similarity=0.983  Sum_probs=2.6

Q ss_pred             cccCCC
Q 000153          308 DRDHGF  313 (2021)
Q Consensus       308 ~rd~g~  313 (2021)
                      +|.|||
T Consensus        99 Arr~G~  104 (652)
T COG2433          99 ARRHGI  104 (652)
T ss_pred             HHHhCC
Confidence            344444


No 95 
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=56.56  E-value=3.2e+02  Score=39.69  Aligned_cols=11  Identities=27%  Similarity=0.265  Sum_probs=4.3

Q ss_pred             CcccCCCCcee
Q 000153         1496 GLTSGSRGKRY 1506 (2021)
Q Consensus      1496 g~~sg~rg~~y 1506 (2021)
                      +..|||.-++-
T Consensus      1246 ~~lSgGek~~~ 1256 (1353)
T TIGR02680      1246 GPASGGERALA 1256 (1353)
T ss_pred             cCCCchHHHHH
Confidence            33344444433


No 96 
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=54.82  E-value=4.6e+02  Score=33.87  Aligned_cols=17  Identities=41%  Similarity=0.499  Sum_probs=10.2

Q ss_pred             ccccccCCCCchhhhcc
Q 000153          189 LQAALPAASGSEKKQKD  205 (2021)
Q Consensus       189 l~a~~p~~~~~~~k~~~  205 (2021)
                      |||..|+--+++.|-|+
T Consensus        82 lqagtpplqVnEEk~~a   98 (672)
T KOG4722|consen   82 LQAGTPPLQVNEEKEKA   98 (672)
T ss_pred             HhcCCCCCCCchhhccc
Confidence            56666666666655543


No 97 
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=54.78  E-value=5e+02  Score=36.06  Aligned_cols=9  Identities=22%  Similarity=0.530  Sum_probs=4.9

Q ss_pred             CCcccccCc
Q 000153          779 NSSTFITQD  787 (2021)
Q Consensus       779 ~SSsF~Pqd  787 (2021)
                      +.-.|+|-+
T Consensus       573 gr~tflpl~  581 (1164)
T TIGR02169       573 GRATFLPLN  581 (1164)
T ss_pred             CCeeeccHh
Confidence            345566653


No 98 
>PF05667 DUF812:  Protein of unknown function (DUF812);  InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function.
Probab=53.79  E-value=4.1e+02  Score=35.69  Aligned_cols=9  Identities=56%  Similarity=0.962  Sum_probs=5.0

Q ss_pred             ccccccccC
Q 000153          187 PSLQAALPA  195 (2021)
Q Consensus       187 psl~a~~p~  195 (2021)
                      |++.+.||.
T Consensus        47 p~~~~~l~~   55 (594)
T PF05667_consen   47 PSLGSSLPR   55 (594)
T ss_pred             ccccCCCcc
Confidence            555555554


No 99 
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=53.10  E-value=1.5e+02  Score=38.35  Aligned_cols=20  Identities=45%  Similarity=0.689  Sum_probs=9.2

Q ss_pred             CCCCCCCCCCCCCCCCCCce
Q 000153           36 HSGYYGSNRARPTGGGGGGM   55 (2021)
Q Consensus        36 ~~g~~~~~~~~~~~~~~ggm   55 (2021)
                      ++|+.+...+++|+++||||
T Consensus        71 ~s~~g~~s~~~gg~~~~~g~   90 (641)
T KOG3915|consen   71 GSGGGGGSSGNGGGGGGGGG   90 (641)
T ss_pred             CCCCCccccCCCCCCCCCCC
Confidence            33443344444445555555


No 100
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=53.09  E-value=3.8e+02  Score=36.97  Aligned_cols=13  Identities=38%  Similarity=0.580  Sum_probs=9.4

Q ss_pred             CCCCCcccceeee
Q 000153         1534 PRRPRRQRTEFRV 1546 (2021)
Q Consensus      1534 ~r~~~~~rtefrv 1546 (2021)
                      +++.+--|||||-
T Consensus      1197 ~~tvlaeRt~l~c 1209 (1265)
T KOG0976|consen 1197 PHTVLAERTELRC 1209 (1265)
T ss_pred             chhhhhhhhheee
Confidence            3456778999984


No 101
>PF06936 Selenoprotein_S:  Selenoprotein S (SelS);  InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. These proteins are involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins which participate in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner []. They probably serve as a linker between DER1, which mediates the retro-translocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.; GO: 0008430 selenium binding, 0006886 intracellular protein transport, 0030176 integral to endoplasmic reticulum membrane; PDB: 2Q2F_A.
Probab=52.98  E-value=77  Score=36.68  Aligned_cols=6  Identities=0%  Similarity=0.063  Sum_probs=0.0

Q ss_pred             CCCccc
Q 000153          524 QDDPFM  529 (2021)
Q Consensus       524 sEDpfM  529 (2021)
                      .|...+
T Consensus        17 ~~~~~~   22 (190)
T PF06936_consen   17 LENEDL   22 (190)
T ss_dssp             ------
T ss_pred             CcchhH
Confidence            333333


No 102
>PRK03918 chromosome segregation protein; Provisional
Probab=52.10  E-value=7e+02  Score=34.05  Aligned_cols=12  Identities=33%  Similarity=0.340  Sum_probs=7.5

Q ss_pred             CCCcCCcccccc
Q 000153          347 RDSETGKVSSSE  358 (2021)
Q Consensus       347 r~~e~~k~~~se  358 (2021)
                      +.|-+||.+.-+
T Consensus        30 G~nG~GKStil~   41 (880)
T PRK03918         30 GQNGSGKSSILE   41 (880)
T ss_pred             cCCCCCHHHHHH
Confidence            346688876544


No 103
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=51.62  E-value=6.7e+02  Score=32.62  Aligned_cols=15  Identities=27%  Similarity=0.250  Sum_probs=7.6

Q ss_pred             cCccCCCcceeeccC
Q 000153          997 TSRCDSQSSLSVSSA 1011 (2021)
Q Consensus       997 t~~~~sqsslsvssp 1011 (2021)
                      .-+|.|=.+-.|=||
T Consensus       383 g~k~asDwtrvvfSp  397 (459)
T KOG0288|consen  383 GFKCASDWTRVVFSP  397 (459)
T ss_pred             ccccccccceeEECC
Confidence            344555555555555


No 104
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=50.98  E-value=6.1e+02  Score=35.24  Aligned_cols=6  Identities=33%  Similarity=0.578  Sum_probs=2.3

Q ss_pred             cCCccc
Q 000153          350 ETGKVS  355 (2021)
Q Consensus       350 e~~k~~  355 (2021)
                      -.||..
T Consensus        33 GsGKS~   38 (1164)
T TIGR02169        33 GSGKSN   38 (1164)
T ss_pred             CCCHHH
Confidence            334433


No 105
>KOG2894 consensus Uncharacterized conserved protein XAP-5 [Function unknown]
Probab=50.25  E-value=1.7e+02  Score=35.78  Aligned_cols=10  Identities=40%  Similarity=0.411  Sum_probs=4.4

Q ss_pred             ccccCCCCCC
Q 000153          729 ITTSASSDSS  738 (2021)
Q Consensus       729 I~TSSSsDSs  738 (2021)
                      |.|++.+.+.
T Consensus       256 IvtkArGKsG  265 (331)
T KOG2894|consen  256 IVTKARGKSG  265 (331)
T ss_pred             HHHHhccCCC
Confidence            4444444443


No 106
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=48.85  E-value=3.5e+02  Score=38.88  Aligned_cols=27  Identities=19%  Similarity=0.267  Sum_probs=14.6

Q ss_pred             cCcccccccccCCCCCCCCCCCCCCCC
Q 000153          424 SSPFRDTVQDDSGRRDIDYGPGGRQPW  450 (2021)
Q Consensus       424 ~sp~r~~~~dd~grRD~GyGrng~qPw  450 (2021)
                      ++-++++.+-.-+.|+.-.||||-..+
T Consensus       309 SeeakdLI~~ll~~~e~RLgrngiedi  335 (1317)
T KOG0612|consen  309 SEEAKDLIEALLCDREVRLGRNGIEDI  335 (1317)
T ss_pred             CHHHHHHHHHHhcChhhhcccccHHHH
Confidence            333444444445566666677775543


No 107
>PF15359 CDV3:  Carnitine deficiency-associated protein 3
Probab=48.68  E-value=44  Score=36.59  Aligned_cols=63  Identities=29%  Similarity=0.421  Sum_probs=33.9

Q ss_pred             CCCCCCCccccccccccCcccCCCCccCCCCCCCCCcccccCCCCCcCC-CCCCccCCCccccccccc-CCCCccccccc
Q 000153          116 TGWTKPGTAVGSDQKINDKVDQGPHSVDGLSKGNDGVGVYVPPSVRSGT-VGPALSSFAPAEKASVLR-GEDFPSLQAAL  193 (2021)
Q Consensus       116 ~gw~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~-~~~~~~~~~~~e~~~vlr-gedfpsl~a~~  193 (2021)
                      .=|.|++++.......-  +...       --...++|||.||.+|-.. .-....+      |==|- =+-||||+||.
T Consensus        59 GPWnk~~~~~~~~~~~~--v~~~-------~~p~~~~gvY~PP~~R~~~~~r~~~qg------aPdI~Se~~FPSL~sta  123 (129)
T PF15359_consen   59 GPWNKSAPAQAPPAPAP--VEEP-------PEPATTSGVYRPPAARNTTTKRKRPQG------APDIFSEEQFPSLQSTA  123 (129)
T ss_pred             CCCcCCCCCCCCCCCCc--cCCC-------CCCCCCCceecCcccccccccCCCCCC------CCCccccccccchHHHh
Confidence            36999887544444432  1111       1135688999999999322 1111111      01111 24799999874


No 108
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=46.83  E-value=2.2e+02  Score=34.87  Aligned_cols=13  Identities=15%  Similarity=0.325  Sum_probs=6.3

Q ss_pred             hhhhhccccCCCC
Q 000153          724 RMVERITTSASSD  736 (2021)
Q Consensus       724 RmVERI~TSSSsD  736 (2021)
                      .+...|+..+.+-
T Consensus       341 ~~a~~i~a~aaga  353 (379)
T COG5269         341 QLAADIKAEAAGA  353 (379)
T ss_pred             HHHHHhhhhhccH
Confidence            3445555554443


No 109
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=46.02  E-value=7.6e+02  Score=35.86  Aligned_cols=15  Identities=33%  Similarity=0.596  Sum_probs=7.1

Q ss_pred             cccc-CCCCCCceeec
Q 000153         1315 LAHM-HPSQPPVFQFG 1329 (2021)
Q Consensus      1315 l~~m-h~s~~plfqfg 1329 (2021)
                      |-|+ |++.+=|++|+
T Consensus      1205 ~v~~~~~~~~~l~~~~ 1220 (1317)
T KOG0612|consen 1205 LVHKGHEFIPFLYHFP 1220 (1317)
T ss_pred             hcCCCCcchHHHhhcc
Confidence            3344 45555454443


No 110
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]
Probab=45.93  E-value=7.7e+02  Score=32.08  Aligned_cols=28  Identities=18%  Similarity=0.165  Sum_probs=14.5

Q ss_pred             ccccccCCccccCCCCCCCCCCCCCCCC
Q 000153          866 NITERYGDVGWGQGRYRGNVHPPYPDRI  893 (2021)
Q Consensus       866 n~~erfGdsgW~~ssS~~rp~PP~peR~  893 (2021)
                      |+..-||..=.+...+++..+|.+.--|
T Consensus       473 ~~~g~~g~~llA~r~sH~s~~~t~~~~m  500 (552)
T KOG2129|consen  473 NSIGEPGHRLLAERRSHGSSPPTVVVQM  500 (552)
T ss_pred             cccCCCchhHHHHHHhcCCCCcchhhhh
Confidence            3334445444555666666665554444


No 111
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]
Probab=45.63  E-value=7.5e+02  Score=34.78  Aligned_cols=8  Identities=25%  Similarity=0.268  Sum_probs=3.1

Q ss_pred             CcccccCC
Q 000153          526 DPFMKDFG  533 (2021)
Q Consensus       526 DpfMeDFG  533 (2021)
                      +.|..++.
T Consensus       312 ~~~~~~~~  319 (980)
T KOG0980|consen  312 DLFEAEPA  319 (980)
T ss_pred             cccccCcc
Confidence            33333343


No 112
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=44.41  E-value=37  Score=42.07  Aligned_cols=29  Identities=38%  Similarity=0.804  Sum_probs=22.6

Q ss_pred             ccccCCCCCCCcccccccccCCCCCCCCC
Q 000153           71 KLSVPPPLNLPSLRKEHERFDSSGSNGGP   99 (2021)
Q Consensus        71 klsvp~plnlpslrkeh~~~d~~~~~~~~   99 (2021)
                      .-.||||-..||.++...-||.-|.-||.
T Consensus       310 nE~~ppppempswqqqq~~~~~~ggrggg  338 (465)
T KOG3973|consen  310 NEMVPPPPEMPSWQQQQHTFDRQGGRGGG  338 (465)
T ss_pred             ccCCCCCCCCCcHHHhcCCCCCCCCcCCC
Confidence            34589999999999998888887654433


No 113
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=44.27  E-value=46  Score=41.89  Aligned_cols=9  Identities=22%  Similarity=-0.027  Sum_probs=3.9

Q ss_pred             cCCCCCCCC
Q 000153          732 SASSDSSGL  740 (2021)
Q Consensus       732 SSSsDSs~~  740 (2021)
                      ..-+++.+.
T Consensus       412 ~~g~dSg~~  420 (506)
T KOG2441|consen  412 GKGLDSGFA  420 (506)
T ss_pred             ccCcccccc
Confidence            344444433


No 114
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=43.95  E-value=1.1e+03  Score=34.14  Aligned_cols=18  Identities=11%  Similarity=0.307  Sum_probs=6.8

Q ss_pred             ccCcccccccccccCCcc
Q 000153          858 EMESDFHENITERYGDVG  875 (2021)
Q Consensus       858 E~dSd~~~n~~erfGdsg  875 (2021)
                      .||+.|..-|.-.||++.
T Consensus       600 ~~d~~~~~~~~~~l~~t~  617 (1163)
T COG1196         600 DFDPKYEPAVRFVLGDTL  617 (1163)
T ss_pred             cCCHHHHHHHHHHhCCeE
Confidence            344433333333444433


No 115
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=43.81  E-value=8.7e+02  Score=35.21  Aligned_cols=7  Identities=43%  Similarity=0.790  Sum_probs=2.8

Q ss_pred             hhccccc
Q 000153         1228 LMDHLNA 1234 (2021)
Q Consensus      1228 ~~~~~~a 1234 (2021)
                      ++||+|.
T Consensus      1168 lVDslDP 1174 (1293)
T KOG0996|consen 1168 LVDSLDP 1174 (1293)
T ss_pred             eeccCCC
Confidence            3444443


No 116
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=42.07  E-value=1.7e+02  Score=37.76  Aligned_cols=8  Identities=50%  Similarity=0.580  Sum_probs=3.3

Q ss_pred             ccccccCC
Q 000153          177 KASVLRGE  184 (2021)
Q Consensus       177 ~~~vlrge  184 (2021)
                      |-|-|||-
T Consensus       178 KmVd~rG~  185 (641)
T KOG3915|consen  178 KMVDLRGA  185 (641)
T ss_pred             eeeeecCc
Confidence            33444443


No 117
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=40.66  E-value=1.2e+03  Score=32.70  Aligned_cols=23  Identities=30%  Similarity=0.592  Sum_probs=13.1

Q ss_pred             cCCCCccceEEEeecccCCCCCCCCCCc
Q 000153         1269 GLSQAETPVKLQFGLFSGPSLIPSPFPA 1296 (2021)
Q Consensus      1269 ~~~~~e~pv~lqfglfsgpslipspvpa 1296 (2021)
                      .+.|++-|.++     -||.-|-|--|-
T Consensus       971 sisqprNpsri-----agp~svtslE~m  993 (1265)
T KOG0976|consen  971 SISQPRNPSRI-----AGPKSVTSLEPM  993 (1265)
T ss_pred             EeecCCCchhh-----cCcccccccccc
Confidence            35566666653     466666655553


No 118
>PLN03188 kinesin-12 family protein; Provisional
Probab=40.47  E-value=1.4e+03  Score=33.74  Aligned_cols=23  Identities=26%  Similarity=0.286  Sum_probs=13.7

Q ss_pred             ccCCccccccccccccccCcccc
Q 000153          407 ERPSSLNREANKETKFMSSPFRD  429 (2021)
Q Consensus       407 vRp~S~~R~~tKe~kY~~sp~r~  429 (2021)
                      +.|+++.=.+...+....+|..+
T Consensus       671 ~~~~~lsi~p~~~~~~l~~p~~s  693 (1320)
T PLN03188        671 ASPSSLSIVPVEVSPVLKSPTLS  693 (1320)
T ss_pred             CCccccccccccccccccCCccc
Confidence            56666666666666666666433


No 119
>PF12004 DUF3498:  Domain of unknown function (DUF3498);  InterPro: IPR021887  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 433 to 538 amino acids in length. This domain is found associated with PF00616 from PFAM, PF00168 from PFAM. This domain has two conserved sequence motifs: DLQ and PLSFQNP. ; PDB: 3BXJ_B.
Probab=38.54  E-value=10  Score=48.66  Aligned_cols=8  Identities=25%  Similarity=-0.055  Sum_probs=0.0

Q ss_pred             CCcccccc
Q 000153          379 GNMWRASS  386 (2021)
Q Consensus       379 ~n~Wr~ss  386 (2021)
                      +..||.++
T Consensus       236 ~~s~rqlS  243 (495)
T PF12004_consen  236 DFSRRQLS  243 (495)
T ss_dssp             --------
T ss_pred             chhhhhcc
Confidence            34444444


No 120
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=37.91  E-value=5.5e+02  Score=36.09  Aligned_cols=15  Identities=20%  Similarity=0.257  Sum_probs=11.0

Q ss_pred             eccceeccccccCCC
Q 000153         1328 FGQLRYTSPVSQGVL 1342 (2021)
Q Consensus      1328 fgqlry~~pi~q~v~ 1342 (2021)
                      |-|+|.-+-+.||-+
T Consensus      1108 ~~qer~er~~Lkg~~ 1122 (1243)
T KOG0971|consen 1108 ISQERHERSILKGAQ 1122 (1243)
T ss_pred             HHHHHHHHHHHhHHH
Confidence            567888877888754


No 121
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=35.50  E-value=26  Score=43.30  Aligned_cols=20  Identities=45%  Similarity=0.790  Sum_probs=9.2

Q ss_pred             CCCCCCCCCCCCCCCCCCce
Q 000153           36 HSGYYGSNRARPTGGGGGGM   55 (2021)
Q Consensus        36 ~~g~~~~~~~~~~~~~~ggm   55 (2021)
                      +||+.|..+|.+||||+||+
T Consensus       441 gggr~gggrgrgggggrg~y  460 (465)
T KOG3973|consen  441 GGGRDGGGRGRGGGGGRGGY  460 (465)
T ss_pred             CCCCCCCCCCCCCCCCCccc
Confidence            44444444444444555553


No 122
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=34.74  E-value=6e+02  Score=34.99  Aligned_cols=12  Identities=25%  Similarity=0.288  Sum_probs=9.6

Q ss_pred             cCCCCCCCCCcc
Q 000153          912 MRHPRVLPPPTL  923 (2021)
Q Consensus       912 ~rqprvlppp~~  923 (2021)
                      ||++-|.++|.-
T Consensus       440 ~~~~~~~~~p~~  451 (916)
T KOG0249|consen  440 MDRMGVMTLPSD  451 (916)
T ss_pred             ccCCccccCccc
Confidence            688999998844


No 123
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]
Probab=34.70  E-value=1.4e+03  Score=33.11  Aligned_cols=31  Identities=26%  Similarity=0.188  Sum_probs=17.6

Q ss_pred             CCCCCCCCCCCCCCccccccc---cccccCCCCCC
Q 000153          887 PPYPDRIYPNPETDVISSFGR---SRYSMRHPRVL  918 (2021)
Q Consensus       887 PP~peR~Yqnsd~d~~~s~~r---~rys~rqprvl  918 (2021)
                      ||+--..--+.|++.+| |+.   -+||+|++|..
T Consensus       617 ~p~n~~~aytldg~~~~-~~g~~~~~ySt~~~~~r  650 (1074)
T KOG0250|consen  617 PPANVTKAYTLDGRQIF-AGGPNYRVYSTRGTRAR  650 (1074)
T ss_pred             CCccceeeeccCccccc-cCCCCcceeccCCCCCC
Confidence            44444442244555553 333   48999998765


No 124
>COG4499 Predicted membrane protein [Function unknown]
Probab=34.64  E-value=90  Score=39.53  Aligned_cols=21  Identities=24%  Similarity=0.327  Sum_probs=8.9

Q ss_pred             hhhhhhhhhhcccccccchhh
Q 000153          548 VGVVKKKKDVLKQTDFHDPVR  568 (2021)
Q Consensus       548 isaIKKKKEelkq~e~EeKrR  568 (2021)
                      .+++|+..+..-...+-...+
T Consensus       347 ~Al~k~~eevksn~~lsg~~r  367 (434)
T COG4499         347 LALTKLYEEVKSNTDLSGDKR  367 (434)
T ss_pred             HHHHHHHHHHhcccCCCchHH
Confidence            344444444433344444433


No 125
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=32.52  E-value=1.8e+03  Score=32.02  Aligned_cols=8  Identities=25%  Similarity=0.505  Sum_probs=4.0

Q ss_pred             CCcccccC
Q 000153          779 NSSTFITQ  786 (2021)
Q Consensus       779 ~SSsF~Pq  786 (2021)
                      +.-+|+|-
T Consensus       567 gr~tflpl  574 (1163)
T COG1196         567 GRATFLPL  574 (1163)
T ss_pred             CccccCch
Confidence            34555553


No 126
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=31.74  E-value=1.6e+03  Score=31.36  Aligned_cols=11  Identities=27%  Similarity=0.323  Sum_probs=6.0

Q ss_pred             CcCCccccccc
Q 000153          349 SETGKVSSSEV  359 (2021)
Q Consensus       349 ~e~~k~~~se~  359 (2021)
                      |=+||.+.=+-
T Consensus        34 nGsGKSSIldA   44 (908)
T COG0419          34 NGAGKSSILDA   44 (908)
T ss_pred             CCCcHHHHHHH
Confidence            45666664443


No 127
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=29.87  E-value=2.1e+02  Score=37.46  Aligned_cols=15  Identities=40%  Similarity=0.523  Sum_probs=8.9

Q ss_pred             CcCCCCCCccccccc
Q 000153          373 SREGREGNMWRASSS  387 (2021)
Q Consensus       373 ~r~g~e~n~Wr~ssp  387 (2021)
                      .|.|++||+-.+.-|
T Consensus       349 aR~gr~G~Aivfl~p  363 (567)
T KOG0345|consen  349 ARAGREGNAIVFLNP  363 (567)
T ss_pred             hhccCccceEEEecc
Confidence            355666666666554


No 128
>KOG2505 consensus Ankyrin repeat protein [General function prediction only]
Probab=29.58  E-value=2.2e+02  Score=37.42  Aligned_cols=8  Identities=25%  Similarity=-0.147  Sum_probs=3.4

Q ss_pred             hccccccc
Q 000153          213 QGMSQELG  220 (2021)
Q Consensus       213 ~~~~~~~~  220 (2021)
                      -.|+++-+
T Consensus       103 ~ils~edF  110 (591)
T KOG2505|consen  103 PILSEEDF  110 (591)
T ss_pred             CcccHHHH
Confidence            34444433


No 129
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=29.11  E-value=9.5e+02  Score=31.63  Aligned_cols=113  Identities=18%  Similarity=0.208  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHH
Q 000153          595 RALELARREEEERLRVAR-EQEEQRRRLEEETREAVW-RAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAAKQKL  672 (2021)
Q Consensus       595 RreEEeRKEEEERERkeR-EEEERrRReEEErRErEE-rEEeEReEaERREEEERrReEEEKRRreEEEERRKEEEEeKR  672 (2021)
                      +.+-..+--++.-.+..+ +.+..+...++...+... +.+..-.+++++.-|.++.+...+.++-.+|.+..+|+.+..
T Consensus       329 qleSqr~y~e~~~~e~~qsqlen~k~~~e~~~~e~~~l~~~~~~~e~~kk~~e~k~~q~q~k~~k~~kel~~~~E~n~~l  408 (493)
T KOG0804|consen  329 QLESQRKYYEQIMSEYEQSQLENQKQYYELLITEADSLKQESSDLEAEKKIVERKLQQLQTKLKKCQKELKEEREENKKL  408 (493)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHHHhhhcchhhhhhccccccc
Q 000153          673 LELEERIAKRQAEAAKSDSNSSDIADEKSSGLAKE  707 (2021)
Q Consensus       673 kEeEEreKKeEaEaEKrereAeakaeEKaraivkE  707 (2021)
                      .+...--...-.+.+++.+++....+++...+.++
T Consensus       409 ~knq~vw~~kl~~~~e~~~~~~~s~d~~I~dLqEQ  443 (493)
T KOG0804|consen  409 IKNQDVWRGKLKELEEREKEALGSKDEKITDLQEQ  443 (493)
T ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


No 130
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=28.74  E-value=7.2e+02  Score=30.85  Aligned_cols=12  Identities=42%  Similarity=0.683  Sum_probs=5.8

Q ss_pred             hhcccccCCCCC
Q 000153          271 VRKQEEYFPGPL  282 (2021)
Q Consensus       271 ~rk~~~~~~gpl  282 (2021)
                      +|-..+||-|-+
T Consensus        16 ~~~~~~~f~~~~   27 (379)
T COG5269          16 ARIHSEYFKGRN   27 (379)
T ss_pred             cChHHHHhcchh
Confidence            344445555543


No 131
>PF00901 Orbi_VP5:  Orbivirus outer capsid protein VP5;  InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid. Cryoelectron microscopy indicates that VP5 is a trimer suggesting that there are 360 copies of VP5 per virion [].; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=28.57  E-value=1.6e+03  Score=30.11  Aligned_cols=10  Identities=20%  Similarity=0.395  Sum_probs=4.3

Q ss_pred             hhhhhhhccc
Q 000153          551 VKKKKDVLKQ  560 (2021)
Q Consensus       551 IKKKKEelkq  560 (2021)
                      +..|-.+++.
T Consensus        89 l~~Kl~eLE~   98 (508)
T PF00901_consen   89 LQRKLKELED   98 (508)
T ss_pred             HHHHHHHHHH
Confidence            3444444443


No 132
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=28.05  E-value=1.5e+02  Score=42.84  Aligned_cols=12  Identities=17%  Similarity=0.390  Sum_probs=6.8

Q ss_pred             CCCCCccccccc
Q 000153          376 GREGNMWRASSS  387 (2021)
Q Consensus       376 g~e~n~Wr~ssp  387 (2021)
                      +-+-.+|.++..
T Consensus      1924 ~~~p~s~~a~~~ 1935 (2220)
T KOG3598|consen 1924 AAAPTSWNAPIA 1935 (2220)
T ss_pred             hcCCccccccch
Confidence            445566766543


No 133
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=27.99  E-value=1.2e+03  Score=31.95  Aligned_cols=14  Identities=21%  Similarity=0.074  Sum_probs=6.4

Q ss_pred             CCCCcchhHhhhcc
Q 000153          261 DTGSARRSEQVRKQ  274 (2021)
Q Consensus       261 ~~g~~~~~e~~rk~  274 (2021)
                      .+|-.|.-=-.||+
T Consensus       210 SLGITCIELAERkP  223 (948)
T KOG0577|consen  210 SLGITCIELAERKP  223 (948)
T ss_pred             eccchhhhhhhcCC
Confidence            34444544344554


No 134
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=26.80  E-value=1.6e+02  Score=42.46  Aligned_cols=6  Identities=33%  Similarity=0.916  Sum_probs=2.9

Q ss_pred             ccccCC
Q 000153          153 GVYVPP  158 (2021)
Q Consensus       153 ~~~~~~  158 (2021)
                      ..|+-|
T Consensus      1772 ~yyL~P 1777 (2220)
T KOG3598|consen 1772 DYYLAP 1777 (2220)
T ss_pred             hhhccC
Confidence            345544


No 135
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin  [Chromatin structure and dynamics]
Probab=25.44  E-value=1.9e+02  Score=35.85  Aligned_cols=12  Identities=25%  Similarity=0.207  Sum_probs=6.3

Q ss_pred             CCCCCeeecCCC
Q 000153          279 PGPLPLVRLKPR  290 (2021)
Q Consensus       279 ~gplplvrl~~~  290 (2021)
                      -|+-|+.+|++-
T Consensus        25 ~g~~~~~h~~y~   36 (410)
T KOG4715|consen   25 GGYNPYTHLAYS   36 (410)
T ss_pred             CCCCcchhhhcc
Confidence            444555566543


No 136
>PLN03188 kinesin-12 family protein; Provisional
Probab=25.32  E-value=2.2e+03  Score=31.93  Aligned_cols=12  Identities=42%  Similarity=0.634  Sum_probs=5.7

Q ss_pred             CccccCCCCCCC
Q 000153           70 PKLSVPPPLNLP   81 (2021)
Q Consensus        70 ~klsvp~plnlp   81 (2021)
                      +||-.|-|.+.|
T Consensus        65 ~~~~sp~p~~pp   76 (1320)
T PLN03188         65 AKLKSPLPPRPP   76 (1320)
T ss_pred             ccccCCCCCCCC
Confidence            444444455544


No 137
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=24.44  E-value=1.6e+03  Score=31.31  Aligned_cols=21  Identities=14%  Similarity=0.188  Sum_probs=11.9

Q ss_pred             hhcccCCCCCCcccCCCCcee
Q 000153         1486 EKSLTGSKAQGLTSGSRGKRY 1506 (2021)
Q Consensus      1486 ~k~~~~~k~~g~~sg~rg~~y 1506 (2021)
                      .+-|-..++-++|+-|+-||+
T Consensus       816 aRq~Le~eF~nLi~~gtdrr~  836 (916)
T KOG0249|consen  816 ARQLLEREFNNLLALGTDRRL  836 (916)
T ss_pred             HHHHHHHHHHhhhcccccccC
Confidence            344455566666666655554


No 138
>KOG3878 consensus Protein involved in maintenance of Golgi structure and ER-Golgi transport [Intracellular trafficking, secretion, and vesicular transport]
Probab=24.29  E-value=1.5e+03  Score=28.88  Aligned_cols=7  Identities=29%  Similarity=0.800  Sum_probs=3.5

Q ss_pred             Ccccccc
Q 000153          768 NSWRRDA  774 (2021)
Q Consensus       768 nswrR~~  774 (2021)
                      .+|-|+.
T Consensus       301 s~WtRpd  307 (469)
T KOG3878|consen  301 SIWTRPD  307 (469)
T ss_pred             hhcCccc
Confidence            3455553


No 139
>PF03154 Atrophin-1:  Atrophin-1 family;  InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA (OMIM:125370) is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins [, ]. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity [].. This entry includes Atrophin-1 and related proteins.
Probab=23.79  E-value=43  Score=45.99  Aligned_cols=8  Identities=13%  Similarity=0.031  Sum_probs=4.0

Q ss_pred             CCCccccC
Q 000153          756 NSSGFLDR  763 (2021)
Q Consensus       756 idSpfldR  763 (2021)
                      -|.+.|..
T Consensus       667 pDTPALRt  674 (982)
T PF03154_consen  667 PDTPALRT  674 (982)
T ss_pred             CCcHHHHH
Confidence            45555533


No 140
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=22.86  E-value=2.4e+03  Score=30.47  Aligned_cols=32  Identities=28%  Similarity=0.444  Sum_probs=19.3

Q ss_pred             cccCCCCCCcccccCCCCCCCCCCCCCCCCcccccccCC-CCCcC
Q 000153          308 DRDHGFSKSEAYWEGDFDMPRPSVLPHKPAHNVFERWGQ-RDSET  351 (2021)
Q Consensus       308 ~rd~g~sk~e~~w~~~fd~~~~~~~p~k~~~~~~~~~gq-r~~e~  351 (2021)
                      |+..|--+.--|++-            ..+|.||-|.-| |--|.
T Consensus        46 GKNnGsVqg~qYF~C------------d~ncG~FVr~sq~r~lEd   78 (1243)
T KOG0971|consen   46 GKNNGSVQGVQYFEC------------DENCGVFVRSSQVRELED   78 (1243)
T ss_pred             CCCCCcccceeeEec------------CCCcceEeehhhhHHhhc
Confidence            466666666667543            146778887777 44443


No 141
>KOG4466 consensus Component of histone deacetylase complex (breast carcinoma metastasis suppressor 1 protein in human) [Cell cycle control, cell division, chromosome partitioning; Transcription]
Probab=22.40  E-value=1.6e+03  Score=28.11  Aligned_cols=6  Identities=17%  Similarity=0.075  Sum_probs=2.7

Q ss_pred             Cccccc
Q 000153          780 SSTFIT  785 (2021)
Q Consensus       780 SSsF~P  785 (2021)
                      -+.|+|
T Consensus       194 ~s~~~P  199 (291)
T KOG4466|consen  194 ESAVQP  199 (291)
T ss_pred             cCCCCC
Confidence            344444


No 142
>PF03154 Atrophin-1:  Atrophin-1 family;  InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA (OMIM:125370) is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins [, ]. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity [].. This entry includes Atrophin-1 and related proteins.
Probab=21.05  E-value=56  Score=45.00  Aligned_cols=9  Identities=22%  Similarity=0.552  Sum_probs=4.2

Q ss_pred             ccccccccc
Q 000153          902 ISSFGRSRY  910 (2021)
Q Consensus       902 ~~s~~r~ry  910 (2021)
                      +..+-|-|.
T Consensus       790 l~~lererl  798 (982)
T PF03154_consen  790 LNPLERERL  798 (982)
T ss_pred             CChHHHHHH
Confidence            344445544


No 143
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]
Probab=20.98  E-value=2.7e+03  Score=30.29  Aligned_cols=17  Identities=24%  Similarity=0.190  Sum_probs=8.4

Q ss_pred             CCccccccccCCCCchh
Q 000153          185 DFPSLQAALPAASGSEK  201 (2021)
Q Consensus       185 dfpsl~a~~p~~~~~~~  201 (2021)
                      ||=-+|+-|+.+.++++
T Consensus       347 ~i~~~q~el~~~~~~e~  363 (1072)
T KOG0979|consen  347 MILDAQAELQETEDPEN  363 (1072)
T ss_pred             HHHHHHhhhhhcCCccc
Confidence            33344555555555544


No 144
>PF07111 HCR:  Alpha helical coiled-coil rod protein (HCR);  InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins. The function of HCR is unknown but it has been implicated in psoriasis in humans and is thought to affect keratinocyte proliferation [].; GO: 0030154 cell differentiation, 0005634 nucleus, 0005737 cytoplasm
Probab=20.26  E-value=2.5e+03  Score=29.53  Aligned_cols=135  Identities=20%  Similarity=0.182  Sum_probs=0.0

Q ss_pred             ccchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000153          563 FHDPVRESFEAELERVQKMQEQERQRIIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRK  642 (2021)
Q Consensus       563 ~EeKrREe~EaELERreKeqEEERKReEEEqKRreEEeRKEEEERERkeREEEERrRReEEErRErEErEEeEReEaERR  642 (2021)
                      +|...+.-.+..++.+.+.+....  +.+...+.++.-+.+.++........+..++.+|+.....-++..+.-.+.-..
T Consensus        78 le~e~~~lre~sl~qkmrLe~qa~--Ele~l~~ae~agraEae~Lraala~ae~~R~~lEE~~q~ELee~q~~Hqeql~~  155 (739)
T PF07111_consen   78 LEEEVRALRETSLQQKMRLEAQAE--ELEALARAEKAGRAEAEELRAALAGAEVVRKNLEEGSQRELEEAQRLHQEQLSS  155 (739)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHH--HHHHHHHHHHhhhhhHHHHHHHHhhHHHHHHhhHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcchhhhh
Q 000153          643 AEEQRIAREEERQRIIMEEERRKHAAKQKLLELEERIAKRQAEAAKSDSNSSDIADE  699 (2021)
Q Consensus       643 EEEERrReEEEKRRreEEEERRKEEEEeKRkEeEEreKKeEaEaEKrereAeakaeE  699 (2021)
                      .-+.-.+.-..-..+.++-++.....+-++..+....+..+.|++..++......++
T Consensus       156 Lt~aHq~~l~sL~~k~~~Le~~L~~le~~r~~e~~~La~~q~e~d~L~~qLsk~~~~  212 (739)
T PF07111_consen  156 LTQAHQEALASLTSKAEELEKSLESLETRRAGEAKELAEAQREADLLREQLSKTQEE  212 (739)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH


Done!