Query         000175
Match_columns 1926
No_of_seqs    391 out of 1543
Neff          3.4 
Searched_HMMs 46136
Date          Thu Mar 28 21:59:51 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/000175.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/000175hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0163 Myosin class VI heavy   99.2 1.7E-10 3.8E-15  140.7  12.7   26  838-863  1166-1191(1259)
  2 KOG1029 Endocytic adaptor prot  98.8   1E-07 2.2E-12  117.9  18.6   59  647-706   400-458 (1118)
  3 PF07001 BAT2_N:  BAT2 N-termin  98.5 4.3E-07 9.3E-12   99.8  10.7   67    8-100    16-82  (189)
  4 PTZ00121 MAEBL; Provisional     98.4 4.2E-06 9.2E-11  108.8  18.1    9   83-91    604-612 (2084)
  5 PTZ00121 MAEBL; Provisional     98.4 5.6E-06 1.2E-10  107.7  17.8    9  318-326   832-840 (2084)
  6 KOG1029 Endocytic adaptor prot  98.4 9.8E-06 2.1E-10  101.0  18.0   17   74-91     87-103 (1118)
  7 PTZ00266 NIMA-related protein   98.0 7.6E-05 1.6E-09   98.3  15.8   25  933-957   781-805 (1021)
  8 PTZ00266 NIMA-related protein   97.9 9.4E-05   2E-09   97.5  15.4   15   52-66     25-39  (1021)
  9 KOG4364 Chromatin assembly fac  97.9 0.00031 6.6E-09   87.6  17.2   21 1272-1292  750-770 (811)
 10 PRK09510 tolA cell envelope in  97.9 0.00083 1.8E-08   81.2  20.3    7  884-890   363-369 (387)
 11 KOG4364 Chromatin assembly fac  97.8 0.00033 7.2E-09   87.3  14.9    8 1299-1306  745-752 (811)
 12 COG3064 TolA Membrane protein   97.5  0.0031 6.8E-08   73.9  17.3    6  916-921   365-370 (387)
 13 PRK09510 tolA cell envelope in  97.4   0.011 2.4E-07   71.9  20.9   19  903-921   350-368 (387)
 14 KOG2891 Surface glycoprotein [  97.3   0.017 3.6E-07   67.1  18.8    9  388-396   157-165 (445)
 15 PF05262 Borrelia_P83:  Borreli  97.2   0.011 2.5E-07   73.5  18.2   13  877-889   477-489 (489)
 16 TIGR02794 tolA_full TolA prote  97.2   0.023   5E-07   68.4  19.9   12  840-851   287-298 (346)
 17 KOG0163 Myosin class VI heavy   97.1  0.0077 1.7E-07   76.2  15.4   32  847-878  1211-1242(1259)
 18 KOG2891 Surface glycoprotein [  97.0   0.035 7.6E-07   64.5  18.4   10  555-564   279-288 (445)
 19 KOG1144 Translation initiation  96.9  0.0071 1.5E-07   77.1  13.1   36 1101-1144  707-742 (1064)
 20 KOG4661 Hsp27-ERE-TATA-binding  96.8  0.0097 2.1E-07   73.5  11.9   18  322-339   355-372 (940)
 21 KOG1144 Translation initiation  96.7  0.0086 1.9E-07   76.4  11.5   12  840-851   474-485 (1064)
 22 KOG2072 Translation initiation  96.7    0.29 6.2E-06   63.7  24.0   13  762-774   897-909 (988)
 23 KOG4661 Hsp27-ERE-TATA-binding  96.0   0.086 1.9E-06   65.7  14.2   20  236-256   256-275 (940)
 24 KOG2412 Nuclear-export-signal   96.0    0.22 4.8E-06   62.5  17.6   35  806-840   420-454 (591)
 25 PF13904 DUF4207:  Domain of un  96.0    0.21 4.6E-06   58.3  16.6    9  659-667   188-196 (264)
 26 KOG2412 Nuclear-export-signal   96.0     0.2 4.2E-06   63.0  16.8   43  817-859   409-456 (591)
 27 KOG4722 Zn-finger protein [Gen  95.8     0.2 4.2E-06   61.1  15.2   27  448-476   187-214 (672)
 28 KOG0742 AAA+-type ATPase [Post  95.2     1.3 2.7E-05   55.0  19.4   11  722-732   253-263 (630)
 29 KOG4817 Unnamed protein [Funct  95.2     0.5 1.1E-05   57.3  15.8   70  277-355   287-375 (468)
 30 PF09726 Macoilin:  Transmembra  94.9    0.46 9.9E-06   62.2  16.1    9  188-196   196-204 (697)
 31 TIGR03319 YmdA_YtgF conserved   94.8    0.72 1.6E-05   58.5  17.0    6  780-785   249-254 (514)
 32 PF12037 DUF3523:  Domain of un  94.5     4.7  0.0001   48.1  21.2    6  538-543    27-32  (276)
 33 KOG2072 Translation initiation  94.4     1.5 3.3E-05   57.5  18.4   10  716-725   742-751 (988)
 34 PRK12704 phosphodiesterase; Pr  94.4     1.1 2.4E-05   57.0  17.1    6  780-785   255-260 (520)
 35 PF12037 DUF3523:  Domain of un  93.8     9.9 0.00021   45.5  21.9   13  545-557    51-63  (276)
 36 PRK00106 hypothetical protein;  93.5     1.5 3.3E-05   56.0  16.1    6  780-785   270-275 (535)
 37 KOG1103 Predicted coiled-coil   89.0      16 0.00035   44.7  17.0   87  913-1011  399-491 (561)
 38 KOG3654 Uncharacterized CH dom  88.2     2.7 5.8E-05   52.9  10.4   20  201-220   115-134 (708)
 39 PRK12705 hypothetical protein;  87.3      15 0.00033   47.1  16.5    7  549-555    23-29  (508)
 40 PF12128 DUF3584:  Protein of u  86.8      26 0.00056   49.1  19.6    6 1229-1234 1168-1173(1201)
 41 PRK00409 recombination and DNA  86.5      19 0.00041   48.4  17.5   11  841-851   734-744 (782)
 42 PF02029 Caldesmon:  Caldesmon;  85.6     3.3 7.1E-05   52.7   9.5    9  876-884   460-468 (492)
 43 PF02029 Caldesmon:  Caldesmon;  85.3     3.3 7.1E-05   52.7   9.4   12  867-880   426-437 (492)
 44 KOG0579 Ste20-like serine/thre  84.6      27 0.00058   46.1  16.4   12  182-193   472-483 (1187)
 45 PRK00409 recombination and DNA  84.3      26 0.00057   47.1  17.3   12  277-288   222-233 (782)
 46 TIGR01069 mutS2 MutS2 family p  84.2      22 0.00049   47.7  16.6   12  277-288   217-228 (771)
 47 PF09731 Mitofilin:  Mitochondr  84.1      75  0.0016   41.0  20.6    7  319-325    27-33  (582)
 48 KOG1103 Predicted coiled-coil   83.0      34 0.00074   42.0  15.7    9  784-792   351-359 (561)
 49 PLN03086 PRLI-interacting fact  83.0     6.5 0.00014   50.9  10.7   12  814-825   183-194 (567)
 50 PTZ00491 major vault protein;   82.9      36 0.00078   46.1  17.2   11  150-160   198-208 (850)
 51 TIGR01069 mutS2 MutS2 family p  82.8      31 0.00067   46.5  17.0    9  842-850   724-732 (771)
 52 KOG0994 Extracellular matrix g  82.2      49  0.0011   46.0  17.8   64  162-232  1193-1261(1758)
 53 KOG0980 Actin-binding protein   81.8   2E+02  0.0043   39.7  22.8   12  525-536   311-322 (980)
 54 KOG1265 Phospholipase C [Lipid  80.6      49  0.0011   45.0  16.9   40  318-364   752-793 (1189)
 55 KOG0161 Myosin class II heavy   79.3      79  0.0017   46.6  19.6    9  185-193   302-310 (1930)
 56 KOG2507 Ubiquitin regulatory p  78.0     5.3 0.00012   49.8   7.2   10  881-890   443-452 (506)
 57 PLN02316 synthase/transferase   77.8      38 0.00082   47.1  15.5   64  769-838   510-576 (1036)
 58 KOG0579 Ste20-like serine/thre  76.8      74  0.0016   42.3  16.5   12  346-357   574-585 (1187)
 59 KOG3654 Uncharacterized CH dom  74.9      20 0.00043   45.7  10.9   17   75-91     17-33  (708)
 60 KOG2689 Predicted ubiquitin re  74.8      26 0.00056   42.1  11.3   14  799-812   250-263 (290)
 61 KOG0161 Myosin class II heavy   72.7 1.6E+02  0.0034   43.8  19.8   11  253-263   454-464 (1930)
 62 KOG0681 Actin-related protein   72.6      36 0.00078   44.2  12.4    6  281-286    23-28  (645)
 63 PF06098 Radial_spoke_3:  Radia  72.1      36 0.00077   41.3  11.8   10  336-345     3-12  (291)
 64 PRK13428 F0F1 ATP synthase sub  72.0 1.2E+02  0.0027   38.5  17.0   10  838-847   255-264 (445)
 65 KOG2689 Predicted ubiquitin re  71.9      34 0.00073   41.2  11.3   13  809-821   249-261 (290)
 66 PTZ00491 major vault protein;   70.5      92   0.002   42.5  15.9    9  150-158   145-153 (850)
 67 KOG0994 Extracellular matrix g  69.8 1.3E+02  0.0029   42.2  16.9    8  723-730  1741-1748(1758)
 68 PF06637 PV-1:  PV-1 protein (P  69.0 2.4E+02  0.0053   35.7  17.7   11  752-762   409-419 (442)
 69 KOG0921 Dosage compensation co  67.5     9.1  0.0002   51.5   6.2   15   45-59   1217-1231(1282)
 70 PF10168 Nup88:  Nuclear pore c  66.7 1.2E+02  0.0027   40.9  16.1   15   81-95     83-97  (717)
 71 KOG1265 Phospholipase C [Lipid  66.4 2.4E+02  0.0052   39.0  18.0   19  341-359   740-758 (1189)
 72 KOG1363 Predicted regulator of  65.5      37  0.0008   43.4  10.6   11  500-510   213-223 (460)
 73 KOG2507 Ubiquitin regulatory p  64.8       9  0.0002   47.9   5.1    8  785-792   345-352 (506)
 74 KOG4848 Extracellular matrix-a  63.4   3E+02  0.0065   32.2  17.8   11  469-479    71-81  (225)
 75 PF06637 PV-1:  PV-1 protein (P  63.3 1.6E+02  0.0034   37.2  14.8   17  518-536   138-154 (442)
 76 KOG4403 Cell surface glycoprot  62.8 2.4E+02  0.0053   36.2  16.3    6  527-532   212-217 (575)
 77 KOG0982 Centrosomal protein Nu  62.4 3.3E+02   0.007   35.2  17.2    9  549-557   225-233 (502)
 78 TIGR02169 SMC_prok_A chromosom  61.6 4.8E+02    0.01   36.0  20.6    9  779-787   573-581 (1164)
 79 PRK04863 mukB cell division pr  61.6 3.9E+02  0.0085   39.2  20.2   40  836-876   727-768 (1486)
 80 KOG1363 Predicted regulator of  60.0      36 0.00078   43.5   9.2    9  291-299    63-71  (460)
 81 KOG4722 Zn-finger protein [Gen  59.8 4.3E+02  0.0093   34.0  17.5   17  189-205    82-98  (672)
 82 PF10168 Nup88:  Nuclear pore c  59.6 1.7E+02  0.0037   39.6  15.5    9  449-457   395-403 (717)
 83 PF05667 DUF812:  Protein of un  59.1 3.2E+02  0.0069   36.5  17.5    9  187-195    47-55  (594)
 84 TIGR02680 conserved hypothetic  58.4 3.4E+02  0.0074   39.3  18.9    6  361-366    57-62  (1353)
 85 KOG0933 Structural maintenance  57.1 5.9E+02   0.013   36.1  19.3   30  531-560   654-685 (1174)
 86 KOG2129 Uncharacterized conser  57.1   5E+02   0.011   33.5  17.5   23  871-893   478-500 (552)
 87 PRK12472 hypothetical protein;  57.0 1.6E+02  0.0034   38.3  13.8   12  908-919   480-491 (508)
 88 KOG0288 WD40 repeat protein Ti  56.8 4.4E+02  0.0096   34.0  17.1   16  996-1011  382-397 (459)
 89 KOG0982 Centrosomal protein Nu  55.0 5.9E+02   0.013   33.0  19.1   13  547-559   220-232 (502)
 90 KOG0976 Rho/Rac1-interacting s  55.0 3.1E+02  0.0066   37.7  15.9   13 1534-1546 1197-1209(1265)
 91 PF15359 CDV3:  Carnitine defic  52.9      35 0.00076   37.1   6.5   63  116-193    59-123 (129)
 92 KOG0249 LAR-interacting protei  52.0 4.7E+02    0.01   35.8  16.8   12  912-923   440-451 (916)
 93 KOG3756 Pinin (desmosome-assoc  51.1 5.9E+02   0.013   31.9  19.5   14  376-389    53-66  (340)
 94 PF05914 RIB43A:  RIB43A;  Inte  50.7 6.3E+02   0.014   32.1  19.4    7  537-543   142-148 (379)
 95 COG4499 Predicted membrane pro  50.4      45 0.00097   41.9   7.6   25  544-568   343-367 (434)
 96 PF12297 EVC2_like:  Ellis van   49.9 3.9E+02  0.0084   34.5  15.3    6  568-573   212-217 (429)
 97 PRK12472 hypothetical protein;  48.9 3.7E+02  0.0079   35.2  15.1    7  470-476   123-129 (508)
 98 KOG0976 Rho/Rac1-interacting s  48.6 8.6E+02   0.019   33.8  18.4   23 1269-1296  971-993 (1265)
 99 KOG0288 WD40 repeat protein Ti  48.0 7.4E+02   0.016   32.1  17.9   18  723-740   156-173 (459)
100 PF04094 DUF390:  Protein of un  47.5 7.6E+02   0.017   33.9  17.8   11  278-288   320-330 (828)
101 PRK03918 chromosome segregatio  47.1 9.1E+02    0.02   32.9  20.5    8  348-355    31-38  (880)
102 PF04094 DUF390:  Protein of un  47.0 7.9E+02   0.017   33.8  17.8    6  745-750   691-696 (828)
103 KOG4572 Predicted DNA-binding   46.4 4.4E+02  0.0096   36.3  15.4   15   69-84    229-243 (1424)
104 KOG3973 Uncharacterized conser  46.2      34 0.00073   42.2   5.6   29   71-99    310-338 (465)
105 PF07227 DUF1423:  Protein of u  44.6 3.7E+02   0.008   34.9  14.1    9  451-459   242-250 (446)
106 PF04111 APG6:  Autophagy prote  44.5 4.2E+02  0.0091   32.6  14.4    6  718-723   167-172 (314)
107 KOG3859 Septins (P-loop GTPase  42.6   4E+02  0.0087   33.0  13.4   12  470-481   121-132 (406)
108 KOG3915 Transcription regulato  42.3 1.8E+02  0.0039   37.4  10.9   20   36-55     71-90  (641)
109 KOG0612 Rho-associated, coiled  42.1 1.3E+03   0.028   33.7  19.2   10 1319-1328 1210-1219(1317)
110 COG5269 ZUO1 Ribosome-associat  40.5 5.1E+02   0.011   31.9  13.6   20  408-427    59-79  (379)
111 KOG3973 Uncharacterized conser  40.3      20 0.00043   44.1   2.6   20   36-55    441-460 (465)
112 KOG0577 Serine/threonine prote  39.4   1E+03   0.022   32.5  16.9   14  261-274   210-223 (948)
113 KOG0612 Rho-associated, coiled  39.3 1.3E+03   0.029   33.6  18.8   17 1348-1364 1202-1218(1317)
114 COG1196 Smc Chromosome segrega  38.9 1.3E+03   0.029   33.0  19.7    6  501-506   141-146 (1163)
115 KOG0804 Cytoplasmic Zn-finger   38.0 7.3E+02   0.016   32.5  15.1   11  376-386   235-245 (493)
116 KOG0250 DNA repair protein RAD  37.4 1.4E+03    0.03   33.0  18.5   16  404-419    85-100 (1074)
117 PLN02316 synthase/transferase   36.5   1E+02  0.0022   43.1   8.6   24 1057-1080  499-522 (1036)
118 KOG3915 Transcription regulato  36.5 1.8E+02  0.0038   37.6   9.6    8  177-184   178-185 (641)
119 COG4372 Uncharacterized protei  36.4 1.1E+03   0.023   30.6  19.3    6  936-941   490-495 (499)
120 PF12004 DUF3498:  Domain of un  35.1      13 0.00027   47.7   0.0    9  571-579   374-382 (495)
121 PF06658 DUF1168:  Protein of u  32.5 3.3E+02  0.0071   30.5   9.9   17  527-543    21-38  (142)
122 COG0711 AtpF F0F1-type ATP syn  32.4 7.5E+02   0.016   27.6  17.2  119  589-707    35-153 (161)
123 KOG1425 Microfibrillar-associa  29.6 5.1E+02   0.011   32.9  11.7    8  276-283    29-36  (430)
124 KOG0971 Microtubule-associated  29.1 1.5E+03   0.032   32.3  16.3   15 1328-1342 1108-1122(1243)
125 KOG2441 mRNA splicing factor/p  29.0 1.1E+02  0.0023   38.8   6.2    9  755-763   414-422 (506)
126 KOG2441 mRNA splicing factor/p  27.1 3.1E+02  0.0066   35.1   9.4    7  473-479   172-178 (506)
127 KOG0345 ATP-dependent RNA heli  26.3 3.1E+02  0.0066   36.0   9.5   14  374-387   350-363 (567)
128 PLN03188 kinesin-12 family pro  26.2 2.3E+03    0.05   31.5  18.0   13   69-81     64-76  (1320)
129 PF00901 Orbi_VP5:  Orbivirus o  25.4 1.7E+03   0.037   29.6  18.4   34  541-575    80-113 (508)
130 KOG0577 Serine/threonine prote  25.1   2E+03   0.042   30.1  18.1    6  538-543   458-463 (948)
131 KOG3598 Thyroid hormone recept  25.0 1.7E+02  0.0037   42.0   7.5   13  376-388  1924-1936(2220)
132 KOG2751 Beclin-like protein [S  24.8 1.3E+03   0.029   30.1  14.3  142  529-676   122-268 (447)
133 KOG0971 Microtubule-associated  24.6 2.3E+03   0.049   30.7  19.2   33  308-352    46-79  (1243)
134 KOG4403 Cell surface glycoprot  24.5 1.5E+03   0.033   29.7  14.5    8  397-404    76-83  (575)
135 KOG3598 Thyroid hormone recept  23.5      60  0.0013   46.1   3.1   12  153-165  1772-1783(2220)
136 KOG2505 Ankyrin repeat protein  23.4 3.5E+02  0.0077   35.5   9.3    7  491-497   307-313 (591)
137 KOG0249 LAR-interacting protei  22.4 1.1E+03   0.023   32.7  13.3   20 1487-1506  817-836 (916)
138 KOG0250 DNA repair protein RAD  21.9 2.6E+03   0.056   30.5  19.3   31  887-919   618-651 (1074)
139 COG4907 Predicted membrane pro  21.6      64  0.0014   41.3   2.6   26   41-107   569-594 (595)
140 KOG4715 SWI/SNF-related matrix  21.3 2.9E+02  0.0062   34.4   7.6   12  279-290    25-36  (410)
141 PF07415 Herpes_LMP2:  Gammaher  21.0      33 0.00072   42.3   0.1   42   92-133    13-54  (489)

No 1  
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=99.15  E-value=1.7e-10  Score=140.71  Aligned_cols=26  Identities=23%  Similarity=0.420  Sum_probs=23.6

Q ss_pred             ccccCcccccCCCCcccccccccccc
Q 000175          838 VSRGQRWNMSGDGDHYGRNIEMESDF  863 (1926)
Q Consensus       838 ~~~~~~WnipgDGD~igRQ~E~dSd~  863 (1926)
                      -.+.++|++||||.||.|||++|++.
T Consensus      1166 ~~k~gmWyaHFdGq~I~RQm~l~~~k 1191 (1259)
T KOG0163|consen 1166 NTKRGMWYAHFDGQWIARQMELHPDK 1191 (1259)
T ss_pred             CCccceEEEecCcHHHHhhheecCCC
Confidence            36789999999999999999999875


No 2  
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.82  E-value=1e-07  Score=117.87  Aligned_cols=59  Identities=20%  Similarity=0.119  Sum_probs=28.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcchhhhhhhhhchhh
Q 000175          647 RIAREEERQRIIMEEERRKHAAKQKLLELEERIAKRQAEAAKSDSNSSDIADEKSSGLAK  706 (1926)
Q Consensus       647 RKRrEEEERRreEEEERRKEEEEeKRkEEEEe~KKeKaE~EKrekeAeakaEEKakqivk  706 (1926)
                      ++++|.|++|+.+.|+.|+++...++.++++..-.+++. .+....+......|..++..
T Consensus       400 aar~ElEkqRqlewErar~qem~~Qk~reqe~iv~~nak-~~ql~~eletLn~k~qqls~  458 (1118)
T KOG1029|consen  400 AAREELEKQRQLEWERARRQEMLNQKNREQEWIVYLNAK-KKQLQQELETLNFKLQQLSG  458 (1118)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHhh
Confidence            334555666666666666655544444444444333322 33333333444444444443


No 3  
>PF07001 BAT2_N:  BAT2 N-terminus;  InterPro: IPR009738 This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2. BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [].
Probab=98.52  E-value=4.3e-07  Score=99.82  Aligned_cols=67  Identities=33%  Similarity=0.434  Sum_probs=46.2

Q ss_pred             cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeeccCcccccCCCccccCCCCCCCcccccc
Q 000175            8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH   87 (1926)
Q Consensus         8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~gg~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh   87 (1926)
                      .||.++|||..|--.+.--+                  -....-..||.+|++-      +.. --||||.||||||.||
T Consensus        16 ~Ky~~l~in~~YkGks~e~q------------------k~~~~~~hGmqsLGKv------~~a-RRmPpPaNLPSLKaEn   70 (189)
T PF07001_consen   16 PKYSSLNINSLYKGKSLEPQ------------------KSTVPRRHGMQSLGKV------PSA-RRMPPPANLPSLKAEN   70 (189)
T ss_pred             ccceeechhhhhcCCccccc------------------cCCccCCCcceecccc------ccc-ccCCCCCCCcchhhhc
Confidence            38999999999933332200                  0122236799999982      111 2289999999999999


Q ss_pred             cccCCCCCCCCCC
Q 000175           88 ERFDSSGSNGGPA  100 (1926)
Q Consensus        88 ~~~d~~~~~~~~~  100 (1926)
                      .++|++-.. .|.
T Consensus        71 ~GnDpnv~l-VP~   82 (189)
T PF07001_consen   71 KGNDPNVSL-VPK   82 (189)
T ss_pred             cCCCCCcee-ecC
Confidence            999977666 454


No 4  
>PTZ00121 MAEBL; Provisional
Probab=98.44  E-value=4.2e-06  Score=108.77  Aligned_cols=9  Identities=56%  Similarity=0.663  Sum_probs=5.6

Q ss_pred             ccccccccC
Q 000175           83 LRKEHERFD   91 (1926)
Q Consensus        83 lrkeh~~~d   91 (1926)
                      --+.-+|||
T Consensus       604 q~~~m~rfd  612 (2084)
T PTZ00121        604 QQKFMERFD  612 (2084)
T ss_pred             HHHHHHhcC
Confidence            345666777


No 5  
>PTZ00121 MAEBL; Provisional
Probab=98.40  E-value=5.6e-06  Score=107.72  Aligned_cols=9  Identities=33%  Similarity=0.545  Sum_probs=5.0

Q ss_pred             ccccCCCCC
Q 000175          318 AYWEGDFDM  326 (1926)
Q Consensus       318 ~~w~~~fd~  326 (1926)
                      |.|+.+|+-
T Consensus       832 pC~e~~~~N  840 (2084)
T PTZ00121        832 PCLEGSFGN  840 (2084)
T ss_pred             ccCCCCCCc
Confidence            556655553


No 6  
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.36  E-value=9.8e-06  Score=101.03  Aligned_cols=17  Identities=47%  Similarity=0.677  Sum_probs=9.5

Q ss_pred             cCCCCCCCcccccccccC
Q 000175           74 VPPPLNLPSLRKEHERFD   91 (1926)
Q Consensus        74 vp~plnlpslrkeh~~~d   91 (1926)
                      ||+-|- |||-|---+|-
T Consensus        87 lP~~LP-Psll~~~~~~~  103 (1118)
T KOG1029|consen   87 LPPVLP-PSLLKQPPRNA  103 (1118)
T ss_pred             CCCCCC-hHHhccCCcCC
Confidence            344333 56777666655


No 7  
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.99  E-value=7.6e-05  Score=98.32  Aligned_cols=25  Identities=28%  Similarity=0.155  Sum_probs=14.1

Q ss_pred             CCCCCCCCCcccccccccccccccc
Q 000175          933 RENECPSPSTFQENEVEYNRLLRSE  957 (1926)
Q Consensus       933 ~~~~~p~ps~f~~~~~~~~~~~r~e  957 (1926)
                      .++.-|+=++=+--++.|+|.-+..
T Consensus       781 ~~~~~~~~~~~~~~~~~~~~~~~~~  805 (1021)
T PTZ00266        781 KEAVNPICSAEAHYERVYNHGNRGG  805 (1021)
T ss_pred             hhhccchhccCCchhccccCCcccc
Confidence            3455555555455666776665553


No 8  
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.94  E-value=9.4e-05  Score=97.50  Aligned_cols=15  Identities=20%  Similarity=0.286  Sum_probs=9.2

Q ss_pred             CCceEEeeccCcccc
Q 000175           52 GGGMLVLSRPRSSQK   66 (1926)
Q Consensus        52 ~ggm~vlsr~r~~~~   66 (1926)
                      +=|.|.|.+.+.+..
T Consensus        25 gFGtVYLAkdk~tg~   39 (1021)
T PTZ00266         25 RFGEVFLVKHKRTQE   39 (1021)
T ss_pred             CCeEEEEEEECCCCe
Confidence            446777777765543


No 9  
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.88  E-value=0.00031  Score=87.57  Aligned_cols=21  Identities=29%  Similarity=0.199  Sum_probs=12.0

Q ss_pred             CCccceEEEeecccCCCCCCC
Q 000175         1272 QAETPVKLQFGLFSGPSLIPS 1292 (1926)
Q Consensus      1272 ~~e~pv~lqfglfsgpslips 1292 (1926)
                      ++-++|+-|+-.-.||+--|.
T Consensus       750 ~~~lqv~~qw~y~l~~~~sp~  770 (811)
T KOG4364|consen  750 DSRLQVKKQWLYKLGLSPSPD  770 (811)
T ss_pred             cccccccceeeeeecCCCCCC
Confidence            355667777666655554333


No 10 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.87  E-value=0.00083  Score=81.21  Aligned_cols=7  Identities=29%  Similarity=0.349  Sum_probs=2.9

Q ss_pred             CCCCCCC
Q 000175          884 NVHPPYP  890 (1926)
Q Consensus       884 rPfPP~~  890 (1926)
                      .+||++|
T Consensus       363 a~lP~pP  369 (387)
T PRK09510        363 AKIPKPP  369 (387)
T ss_pred             CCCCCCC
Confidence            3444443


No 11 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.76  E-value=0.00033  Score=87.27  Aligned_cols=8  Identities=13%  Similarity=0.111  Sum_probs=3.8

Q ss_pred             eccccCcc
Q 000175         1299 IGSIQMPL 1306 (1926)
Q Consensus      1299 igsiqmpl 1306 (1926)
                      |-+.|.|=
T Consensus       745 l~~Fq~~~  752 (811)
T KOG4364|consen  745 LSDFQDSR  752 (811)
T ss_pred             HHhccccc
Confidence            34555553


No 12 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.52  E-value=0.0031  Score=73.90  Aligned_cols=6  Identities=33%  Similarity=1.004  Sum_probs=2.2

Q ss_pred             CCCCCC
Q 000175          916 RVLPPP  921 (1926)
Q Consensus       916 rvlppp  921 (1926)
                      -||+||
T Consensus       365 kiP~pp  370 (387)
T COG3064         365 KIPKPP  370 (387)
T ss_pred             cCCCCC
Confidence            333333


No 13 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.41  E-value=0.011  Score=71.91  Aligned_cols=19  Identities=11%  Similarity=0.336  Sum_probs=9.5

Q ss_pred             ccccccccccCCCCCCCCC
Q 000175          903 SSFGRSRYSMRHPRVLPPP  921 (1926)
Q Consensus       903 ~~~~r~rys~rqprvlppp  921 (1926)
                      ..|||.=.+...-.+||+|
T Consensus       350 ~aldrAA~~Aar~a~lP~p  368 (387)
T PRK09510        350 PALCQAALAAAKTAKIPKP  368 (387)
T ss_pred             HHHHHHHHHHHHcCCCCCC
Confidence            4677754444333444444


No 14 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.25  E-value=0.017  Score=67.05  Aligned_cols=9  Identities=11%  Similarity=0.021  Sum_probs=5.0

Q ss_pred             cccCCcccc
Q 000175          388 LQKDGFGAL  396 (1926)
Q Consensus       388 l~K~w~~a~  396 (1926)
                      |+-.||.-.
T Consensus       157 ip~kwf~lk  165 (445)
T KOG2891|consen  157 IPCKWFALK  165 (445)
T ss_pred             Ccceeeeec
Confidence            555677543


No 15 
>PF05262 Borrelia_P83:  Borrelia P83/100 protein;  InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=97.20  E-value=0.011  Score=73.49  Aligned_cols=13  Identities=0%  Similarity=-0.010  Sum_probs=7.7

Q ss_pred             cCCCCCCCCCCCC
Q 000175          877 GQGRYRGNVHPPY  889 (1926)
Q Consensus       877 ~qSsS~~rPfPP~  889 (1926)
                      +.|.-...||.++
T Consensus       477 a~S~~eV~P~T~~  489 (489)
T PF05262_consen  477 AKSEVEVLPFTSF  489 (489)
T ss_pred             hcCccccCCCCCC
Confidence            3566666666653


No 16 
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=97.17  E-value=0.023  Score=68.35  Aligned_cols=12  Identities=25%  Similarity=0.335  Sum_probs=5.3

Q ss_pred             ccCcccccCCCC
Q 000175          840 RGQRWNMSGDGD  851 (1926)
Q Consensus       840 ~~~~WnipgDGD  851 (1926)
                      |...+.+.-||.
T Consensus       287 v~V~I~L~pdG~  298 (346)
T TIGR02794       287 CRLRIRLAPDGT  298 (346)
T ss_pred             EEEEEEECCCCC
Confidence            334444444453


No 17 
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=97.10  E-value=0.0077  Score=76.25  Aligned_cols=32  Identities=22%  Similarity=0.177  Sum_probs=27.7

Q ss_pred             cCCCCccccccccccccccchhhccCCccccC
Q 000175          847 SGDGDHYGRNIEMESDFHENITERYGDVGWGQ  878 (1926)
Q Consensus       847 pgDGD~igRQ~E~dSd~~~N~~erfGdsgW~q  878 (1926)
                      ...|.+-.|-.|+-++-|+.+|||||+..+.+
T Consensus      1211 eeTgL~rKrGAEI~~~eFe~~W~r~Ggk~~~~ 1242 (1259)
T KOG0163|consen 1211 EETGLTRKRGAEILEHEFEREWERNGGKAYKN 1242 (1259)
T ss_pred             HhhccccccccccChHHHHHHHHHhCcHHhHh
Confidence            34677888999999999999999999988876


No 18 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.02  E-value=0.035  Score=64.49  Aligned_cols=10  Identities=10%  Similarity=0.132  Sum_probs=3.9

Q ss_pred             hhhccccccc
Q 000175          555 KDVLKQTDFH  564 (1926)
Q Consensus       555 KEe~Kqae~E  564 (1926)
                      .++.++.+.+
T Consensus       279 aeerrqiete  288 (445)
T KOG2891|consen  279 AEERRQIETE  288 (445)
T ss_pred             HHHHhhhhHH
Confidence            3333444433


No 19 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.94  E-value=0.0071  Score=77.07  Aligned_cols=36  Identities=25%  Similarity=0.238  Sum_probs=18.2

Q ss_pred             ccCCCCCcccccchhhhhcccccccCCCCcccceeeeccCceec
Q 000175         1101 EDVPEGDDENIELTQEFEGIHLEEKGSPHMMSNLVLGFNEGVEV 1144 (1926)
Q Consensus      1101 ed~~~~~den~~l~~e~~~~hl~~k~~p~~~~~~vlgf~egv~v 1144 (1926)
                      .-.|++--.-||.-  +.|+-|      |+=|-+|||=-.|--|
T Consensus       707 VKvieG~GtTIDVi--LvNG~L------~eGD~IvvcG~~GpIv  742 (1064)
T KOG1144|consen  707 VKVIEGHGTTIDVI--LVNGEL------HEGDQIVVCGLQGPIV  742 (1064)
T ss_pred             EEeecCCCceEEEE--EEccee------ccCCEEEEcCCCCchh
Confidence            33444446666653  344333      3446677654445433


No 20 
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.75  E-value=0.0097  Score=73.54  Aligned_cols=18  Identities=22%  Similarity=0.442  Sum_probs=12.3

Q ss_pred             CCCCCCCCCCCCCCCCCc
Q 000175          322 GDFDMPRPSVLPHKPAHN  339 (1926)
Q Consensus       322 ~~fd~~~~~~~p~k~~~~  339 (1926)
                      +-|||---.-||+-|.-.
T Consensus       355 rKfdfdAcnevpPapkeS  372 (940)
T KOG4661|consen  355 RKFDFDACNEVPPAPKES  372 (940)
T ss_pred             ccccccccccCCCCCccc
Confidence            467887777777665554


No 21 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.73  E-value=0.0086  Score=76.35  Aligned_cols=12  Identities=25%  Similarity=0.238  Sum_probs=5.8

Q ss_pred             ccCcccccCCCC
Q 000175          840 RGQRWNMSGDGD  851 (1926)
Q Consensus       840 ~~~~WnipgDGD  851 (1926)
                      +.+..|+-|-.|
T Consensus       474 RSPIcCilGHVD  485 (1064)
T KOG1144|consen  474 RSPICCILGHVD  485 (1064)
T ss_pred             CCceEEEeeccc
Confidence            444555555443


No 22 
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=96.66  E-value=0.29  Score=63.75  Aligned_cols=13  Identities=38%  Similarity=0.654  Sum_probs=9.0

Q ss_pred             cCCCCCCcccccc
Q 000175          762 DRGKPFNSWRRDA  774 (1926)
Q Consensus       762 dR~Kp~~SwrR~h  774 (1926)
                      .|..+.+.|+|.-
T Consensus       897 ~~a~~~~~WrR~a  909 (988)
T KOG2072|consen  897 PRAPEEAEWRRGA  909 (988)
T ss_pred             CCCCcchHHhhcc
Confidence            4555677788875


No 23 
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.03  E-value=0.086  Score=65.71  Aligned_cols=20  Identities=10%  Similarity=-0.019  Sum_probs=12.3

Q ss_pred             CCcccccCCCcccCCccccCC
Q 000175          236 GMSPRLQSGQDVVGSRLRENG  256 (1926)
Q Consensus       236 ~m~pq~~~~~~~~g~~~~~~~  256 (1926)
                      -..|-+.+-+.+.|.+ ++++
T Consensus       256 eeedlfdSahpeegDl-Dlas  275 (940)
T KOG4661|consen  256 EEEDLFDSAHPEEGDL-DLAS  275 (940)
T ss_pred             hccccccccCCccccc-cccc
Confidence            3456666777777775 4443


No 24 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=96.02  E-value=0.22  Score=62.54  Aligned_cols=35  Identities=6%  Similarity=-0.080  Sum_probs=29.5

Q ss_pred             CCCcccCCCCCcccccCcccccccccchhhhcccc
Q 000175          806 VPRKEFYGGPGIMSSRNYYKAGILEPHMDEFTVSR  840 (1926)
Q Consensus       806 fpr~efyggagFvKKrPY~~gGftD~hLeDYr~~~  840 (1926)
                      ||+.--...+.+.|+|||..+..++...++|.+.-
T Consensus       420 ~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~m  454 (591)
T KOG2412|consen  420 FPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMM  454 (591)
T ss_pred             CchHHHHHHHHHHhcCCccccccccCcHHHHHHhh
Confidence            77777777889999999999999998888887543


No 25 
>PF13904 DUF4207:  Domain of unknown function (DUF4207)
Probab=95.98  E-value=0.21  Score=58.25  Aligned_cols=9  Identities=22%  Similarity=0.250  Sum_probs=3.4

Q ss_pred             HHHHHHHHH
Q 000175          659 MEEERRKHA  667 (1926)
Q Consensus       659 EEEERRKEE  667 (1926)
                      +.++++.++
T Consensus       188 ~W~~kK~~e  196 (264)
T PF13904_consen  188 EWERKKKEE  196 (264)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 26 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=95.95  E-value=0.2  Score=62.98  Aligned_cols=43  Identities=5%  Similarity=-0.043  Sum_probs=26.4

Q ss_pred             cccccCccccccccc---chhhhcccccCcccccCCCC--cccccccc
Q 000175          817 IMSSRNYYKAGILEP---HMDEFTVSRGQRWNMSGDGD--HYGRNIEM  859 (1926)
Q Consensus       817 FvKKrPY~~gGftD~---hLeDYr~~~~~~WnipgDGD--~igRQ~E~  859 (1926)
                      |.+.+.|+--.++|-   .|+.+++.|+=.-.++.+.+  .+.+.|.+
T Consensus       409 la~V~l~i~~q~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~mGy  456 (591)
T KOG2412|consen  409 LAKVILYIWSQFPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMMGY  456 (591)
T ss_pred             HHHHHHHHHHhCchHHHHHHHHHHhcCCccccccccCcHHHHHHhhcc
Confidence            456666666666665   77899999975544444444  44444443


No 27 
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=95.76  E-value=0.2  Score=61.05  Aligned_cols=27  Identities=19%  Similarity=0.449  Sum_probs=24.0

Q ss_pred             CCCcccccccccccccC-CCCcccCccccc
Q 000175          448 QPWNNSVHSFNSQRAER-NPWEQYGSEQYN  476 (1926)
Q Consensus       448 qpWn~mmsSfs~Re~eR-t~~e~wGi~qyn  476 (1926)
                      ..||+.+++|..++.|| ++  +||+.+-+
T Consensus       187 ~dwndvladyea~eswrent--a~gdi~ee  214 (672)
T KOG4722|consen  187 ADWNDVLADYEAEESWRENT--AQGDIHEE  214 (672)
T ss_pred             cchhhHHHHHHHHHHHHhcc--hhhhhhcc
Confidence            56999999999999999 66  89998776


No 28 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=95.19  E-value=1.3  Score=55.04  Aligned_cols=11  Identities=36%  Similarity=0.534  Sum_probs=5.8

Q ss_pred             hhhhHhhhccC
Q 000175          722 GERMVERITTS  732 (1926)
Q Consensus       722 ~ERmverI~tS  732 (1926)
                      -+..++.|+|.
T Consensus       253 Rekwl~aInTt  263 (630)
T KOG0742|consen  253 REKWLEAINTT  263 (630)
T ss_pred             HHHHHHHHhhh
Confidence            34455666655


No 29 
>KOG4817 consensus Unnamed protein [Function unknown]
Probab=95.18  E-value=0.5  Score=57.26  Aligned_cols=70  Identities=23%  Similarity=0.357  Sum_probs=44.4

Q ss_pred             cCCCCCCeeecCCC------------CCCcccccccCCCCccccccCCCCCCcccccCCCCCC-------CCCCCCCCCC
Q 000175          277 YFPGPLPLVRLKPR------------SDWADDERDTGHGITDRDRDHGFSKSEAYWEGDFDMP-------RPSVLPHKPA  337 (1926)
Q Consensus       277 ~~~gplplvrl~~~------------sdwadderdt~~~~~~r~r~~g~sk~e~~w~~~fd~~-------~~~~~p~k~~  337 (1926)
                      |.-=+||-||+.++            -||-||+|.     ..+.+-||-+.--.|-+...|.|       .-+|-|+|--
T Consensus       287 ~~s~~lpQ~r~~~~~~~~q~~~q~~~Qd~~~~~~~-----v~mt~~~~~~~~~~~r~g~~~~~~~s~~~~e~s~~~~~~t  361 (468)
T KOG4817|consen  287 GKSHYLPQVRHAGHQNHHQHQHQQQHQDHHHQQQQ-----VHMTYHHGHGRQRDYRDGSDDVGGGSADLGELSLRPQNDT  361 (468)
T ss_pred             ccccccchhcccccchHHHHHHHHhhhhcchhhhh-----hhhhhccCCceeeeccCCccCCCccccccccccccccccc
Confidence            55558899999875            489999984     44556667666666766666666       3355565532


Q ss_pred             CccccccccCCccccccc
Q 000175          338 HNVFERWGQRDSETGKVS  355 (1926)
Q Consensus       338 ~~~~~~~gqr~~~~~k~~  355 (1926)
                      +    -|-|-..-+.||-
T Consensus       362 ~----~~~~~~~~~~k~~  375 (468)
T KOG4817|consen  362 A----AWLQQQEKAAKVA  375 (468)
T ss_pred             C----CccccCchHHHHH
Confidence            2    2555444454543


No 30 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=94.94  E-value=0.46  Score=62.18  Aligned_cols=9  Identities=56%  Similarity=0.693  Sum_probs=5.0

Q ss_pred             cccccccCC
Q 000175          188 SLQAALPAA  196 (1926)
Q Consensus       188 sl~a~~p~~  196 (1926)
                      .|+-+||+.
T Consensus       196 ~l~~~lp~~  204 (697)
T PF09726_consen  196 LLQQALPPE  204 (697)
T ss_pred             HHHHhCCCc
Confidence            455566554


No 31 
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=94.84  E-value=0.72  Score=58.54  Aligned_cols=6  Identities=33%  Similarity=0.130  Sum_probs=3.6

Q ss_pred             cccccC
Q 000175          780 SSTFIT  785 (1926)
Q Consensus       780 sS~F~P  785 (1926)
                      -|+|-|
T Consensus       249 ls~fdp  254 (514)
T TIGR03319       249 LSGFDP  254 (514)
T ss_pred             ecCCch
Confidence            566655


No 32 
>PF12037 DUF3523:  Domain of unknown function (DUF3523);  InterPro: IPR021911  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif. 
Probab=94.47  E-value=4.7  Score=48.08  Aligned_cols=6  Identities=50%  Similarity=0.683  Sum_probs=3.3

Q ss_pred             CCCCCc
Q 000175          538 DGRDPF  543 (1926)
Q Consensus       538 DgrDP~  543 (1926)
                      -++||.
T Consensus        27 ~~FDP~   32 (276)
T PF12037_consen   27 SGFDPE   32 (276)
T ss_pred             CCCCcH
Confidence            355655


No 33 
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=94.42  E-value=1.5  Score=57.51  Aligned_cols=10  Identities=40%  Similarity=0.308  Sum_probs=3.9

Q ss_pred             CCCchhhhhh
Q 000175          716 VGDWEDGERM  725 (1926)
Q Consensus       716 ~dDwEd~ERm  725 (1926)
                      +.+|....+|
T Consensus       742 vk~k~~l~rm  751 (988)
T KOG2072|consen  742 VKDKKRLSRM  751 (988)
T ss_pred             HHHHHHHHHH
Confidence            3344433333


No 34 
>PRK12704 phosphodiesterase; Provisional
Probab=94.38  E-value=1.1  Score=57.05  Aligned_cols=6  Identities=33%  Similarity=0.130  Sum_probs=3.0

Q ss_pred             cccccC
Q 000175          780 SSTFIT  785 (1926)
Q Consensus       780 sS~F~P  785 (1926)
                      -|+|-|
T Consensus       255 ls~~~~  260 (520)
T PRK12704        255 LSGFDP  260 (520)
T ss_pred             EecCCh
Confidence            445544


No 35 
>PF12037 DUF3523:  Domain of unknown function (DUF3523);  InterPro: IPR021911  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif. 
Probab=93.77  E-value=9.9  Score=45.52  Aligned_cols=13  Identities=15%  Similarity=0.304  Sum_probs=5.8

Q ss_pred             hhhHHHHHhhhhh
Q 000175          545 AGLVGVVKKKKDV  557 (1926)
Q Consensus       545 ~~vlsliKKKKEe  557 (1926)
                      -.++.+++++++.
T Consensus        51 k~afel~k~QE~T   63 (276)
T PF12037_consen   51 KKAFELMKKQEET   63 (276)
T ss_pred             HHHHHHHHHHHHH
Confidence            3344554444333


No 36 
>PRK00106 hypothetical protein; Provisional
Probab=93.54  E-value=1.5  Score=55.99  Aligned_cols=6  Identities=33%  Similarity=0.130  Sum_probs=3.4

Q ss_pred             cccccC
Q 000175          780 SSTFIT  785 (1926)
Q Consensus       780 sS~F~P  785 (1926)
                      -|+|-|
T Consensus       270 lS~fdp  275 (535)
T PRK00106        270 LSGFDP  275 (535)
T ss_pred             EeCCCh
Confidence            555655


No 37 
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=89.03  E-value=16  Score=44.69  Aligned_cols=87  Identities=20%  Similarity=0.160  Sum_probs=40.0

Q ss_pred             CCCCCCCCCccccccCCCCCCCCCCC---CCCccccccccc---ccccccccccccccccccccccCcccccccCCCCCc
Q 000175          913 RHPRVLPPPTLTSMQKPSYRRENECP---SPSTFQENEVEY---NRLLRSESISLAGLDRSEQHNLAQPEIIDVQPESTE  986 (1926)
Q Consensus       913 rqprvlppp~~~~~~~~s~~~~~~~p---~ps~f~~~~~~~---~~~~r~e~t~~~~~~~~~~~~~~~~~~~~~~~~~~~  986 (1926)
                      +-||.+|||+.+.+-++| .|.+-.|   +-|+....-+--   -.-.-.-+..-++|.++||+...|.--       + 
T Consensus       399 gcP~~ie~~VpmPsPl~S-~GsslspS~~ASSSlt~~pcSSPV~~k~llGssaSSp~~qssyqvginqrfh-------a-  469 (561)
T KOG1103|consen  399 GCPRAIEPAVPMPSPLMS-IGSSLSPSLPASSSLTPRPCSSPVKKKPLLGSSASSPAVQSSYQVGINQRFH-------A-  469 (561)
T ss_pred             CCCCCCCCCCCCCCcccc-cccccCCCCcccccCCCCCCCCccccccccccccCChhhhhhhhhcchhhhh-------h-
Confidence            457777877776666633 3433222   222111111000   000001123446778888875444221       1 


Q ss_pred             hhhhcccccccCccCCCcceeeccC
Q 000175          987 NEEQNLERSTTSRCDSQSSLSVSSA 1011 (1926)
Q Consensus       987 ~e~q~~~r~~t~~~~sqsslsvssp 1011 (1926)
                       -.|++-  ++.-.|-|+|.-.|+|
T Consensus       470 -aRhkf~--aqad~dqqasgl~sp~  491 (561)
T KOG1103|consen  470 -ARHKFA--AQADMDQQASGLNSPA  491 (561)
T ss_pred             -ccchhh--hcccCcccccccCCCc
Confidence             123333  4666777777655544


No 38 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=88.16  E-value=2.7  Score=52.85  Aligned_cols=20  Identities=25%  Similarity=0.275  Sum_probs=12.0

Q ss_pred             hhhcccchhHhhhccccccc
Q 000175          201 KKQKDGFSQKQKQGMSQELG  220 (1926)
Q Consensus       201 ~k~~~~~~qk~k~~~~~~~~  220 (1926)
                      +|.-+.+.-||+|.|+.--+
T Consensus       115 kkkmea~fakqrqklgksaf  134 (708)
T KOG3654|consen  115 KKKMEAIFAKQRQKLGKSAF  134 (708)
T ss_pred             HHHHHHHHHHHHHHhchhhe
Confidence            34445566677777766544


No 39 
>PRK12705 hypothetical protein; Provisional
Probab=87.29  E-value=15  Score=47.14  Aligned_cols=7  Identities=29%  Similarity=0.520  Sum_probs=2.8

Q ss_pred             HHHHhhh
Q 000175          549 GVVKKKK  555 (1926)
Q Consensus       549 sliKKKK  555 (1926)
                      .+++++.
T Consensus        23 ~~~~~~~   29 (508)
T PRK12705         23 VLLKKRQ   29 (508)
T ss_pred             HHHHHHH
Confidence            3344443


No 40 
>PF12128 DUF3584:  Protein of unknown function (DUF3584);  InterPro: IPR021979  This family consist of uncharacterised bacterial proteins. 
Probab=86.80  E-value=26  Score=49.12  Aligned_cols=6  Identities=33%  Similarity=0.534  Sum_probs=2.3

Q ss_pred             hccccc
Q 000175         1229 MDHLNA 1234 (1926)
Q Consensus      1229 ~~~~~a 1234 (1926)
                      ++-|+.
T Consensus      1168 ~~~~~~ 1173 (1201)
T PF12128_consen 1168 LDMCNS 1173 (1201)
T ss_pred             HHHHHh
Confidence            333333


No 41 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=86.50  E-value=19  Score=48.41  Aligned_cols=11  Identities=27%  Similarity=0.570  Sum_probs=6.1

Q ss_pred             cCcccccCCCC
Q 000175          841 GQRWNMSGDGD  851 (1926)
Q Consensus       841 ~~~WnipgDGD  851 (1926)
                      ...|=+||-|.
T Consensus       734 ~~v~IIHGkGt  744 (782)
T PRK00409        734 GEVLIIHGKGT  744 (782)
T ss_pred             CEEEEEcCCCh
Confidence            44556666553


No 42 
>PF02029 Caldesmon:  Caldesmon;  InterPro: IPR006018  This group of proteins includes two protein families: caldesmon and lymphocyte specific protein.  Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart). 
Probab=85.59  E-value=3.3  Score=52.71  Aligned_cols=9  Identities=22%  Similarity=0.493  Sum_probs=3.7

Q ss_pred             ccCCCCCCC
Q 000175          876 WGQGRYRGN  884 (1926)
Q Consensus       876 W~qSsS~~r  884 (1926)
                      |+.....++
T Consensus       460 w~~~~~e~~  468 (492)
T PF02029_consen  460 WLTKTPEGS  468 (492)
T ss_pred             hhcCCCCCC
Confidence            444444444


No 43 
>PF02029 Caldesmon:  Caldesmon;  InterPro: IPR006018  This group of proteins includes two protein families: caldesmon and lymphocyte specific protein.  Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart). 
Probab=85.32  E-value=3.3  Score=52.68  Aligned_cols=12  Identities=8%  Similarity=0.006  Sum_probs=5.9

Q ss_pred             hhhccCCccccCCC
Q 000175          867 ITERYGDVGWGQGR  880 (1926)
Q Consensus       867 ~~erfGdsgW~qSs  880 (1926)
                      +||  .|--|+++.
T Consensus       426 ~we--~g~v~~~~~  437 (492)
T PF02029_consen  426 MWE--KGNVFSSSA  437 (492)
T ss_pred             hcc--cCCcccCCC
Confidence            455  444555433


No 44 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=84.63  E-value=27  Score=46.06  Aligned_cols=12  Identities=33%  Similarity=0.421  Sum_probs=7.1

Q ss_pred             ccCCCccccccc
Q 000175          182 RGEDFPSLQAAL  193 (1926)
Q Consensus       182 rgedfpsl~a~~  193 (1926)
                      -|+-|-++|++.
T Consensus       472 ~G~~~~s~qs~~  483 (1187)
T KOG0579|consen  472 QGSTFFSPQSSA  483 (1187)
T ss_pred             cCccccCccccC
Confidence            455555666665


No 45 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=84.33  E-value=26  Score=47.11  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=5.4

Q ss_pred             cCCCCCCeeecC
Q 000175          277 YFPGPLPLVRLK  288 (1926)
Q Consensus       277 ~~~gplplvrl~  288 (1926)
                      +|.-|..+|-|+
T Consensus       222 ~y~ep~~~~~ln  233 (782)
T PRK00409        222 LYIEPQSVVELN  233 (782)
T ss_pred             EEEEcHHHHHHH
Confidence            444444455444


No 46 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=84.23  E-value=22  Score=47.70  Aligned_cols=12  Identities=25%  Similarity=0.744  Sum_probs=6.3

Q ss_pred             cCCCCCCeeecC
Q 000175          277 YFPGPLPLVRLK  288 (1926)
Q Consensus       277 ~~~gplplvrl~  288 (1926)
                      +|.-|..+|-||
T Consensus       217 ~~~ep~~~~~ln  228 (771)
T TIGR01069       217 FYIEPQAIVKLN  228 (771)
T ss_pred             EEEEcHHHHHHH
Confidence            445555555554


No 47 
>PF09731 Mitofilin:  Mitochondrial inner membrane protein;  InterPro: IPR019133  Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=84.13  E-value=75  Score=41.04  Aligned_cols=7  Identities=14%  Similarity=0.245  Sum_probs=2.9

Q ss_pred             cccCCCC
Q 000175          319 YWEGDFD  325 (1926)
Q Consensus       319 ~w~~~fd  325 (1926)
                      ||++.|+
T Consensus        27 ~~n~~f~   33 (582)
T PF09731_consen   27 KQNDNFR   33 (582)
T ss_pred             hcChHHH
Confidence            3444443


No 48 
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=83.04  E-value=34  Score=42.03  Aligned_cols=9  Identities=33%  Similarity=0.652  Sum_probs=4.6

Q ss_pred             cCCccccCC
Q 000175          784 ITQDAENGH  792 (1926)
Q Consensus       784 ~Pqd~ENg~  792 (1926)
                      +|++-.|||
T Consensus       351 ~~~ak~ngh  359 (561)
T KOG1103|consen  351 LPPAKGNGH  359 (561)
T ss_pred             CCcccCCCC
Confidence            344555555


No 49 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=83.03  E-value=6.5  Score=50.86  Aligned_cols=12  Identities=0%  Similarity=-0.415  Sum_probs=6.5

Q ss_pred             CCCcccccCccc
Q 000175          814 GPGIMSSRNYYK  825 (1926)
Q Consensus       814 gagFvKKrPY~~  825 (1926)
                      ...|+|-.|-..
T Consensus       183 kgt~vklqP~~~  194 (567)
T PLN03086        183 KGTYAKLQPDGV  194 (567)
T ss_pred             CCCEEEEeeccC
Confidence            344666665544


No 50 
>PTZ00491 major vault protein; Provisional
Probab=82.91  E-value=36  Score=46.12  Aligned_cols=11  Identities=27%  Similarity=0.552  Sum_probs=6.1

Q ss_pred             CCcccccCCCC
Q 000175          150 DGVGVYVPPSV  160 (1926)
Q Consensus       150 ~~~~~~~~~s~  160 (1926)
                      ++.|.|+|..-
T Consensus       198 t~~gaylP~v~  208 (850)
T PTZ00491        198 RTPGAYLPGVF  208 (850)
T ss_pred             eccccccCCCc
Confidence            44666666543


No 51 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=82.77  E-value=31  Score=46.45  Aligned_cols=9  Identities=22%  Similarity=0.335  Sum_probs=4.5

Q ss_pred             CcccccCCC
Q 000175          842 QRWNMSGDG  850 (1926)
Q Consensus       842 ~~WnipgDG  850 (1926)
                      ..+=+||-|
T Consensus       724 ~v~IIHGkG  732 (771)
T TIGR01069       724 VVLIIHGKG  732 (771)
T ss_pred             EEEEEcCCC
Confidence            344556644


No 52 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=82.18  E-value=49  Score=45.97  Aligned_cols=64  Identities=25%  Similarity=0.294  Sum_probs=35.2

Q ss_pred             cCCCCCCCCCCCccccceeeccCCCccccccccCCCCchh--hhcccch---hHhhhccccccccccccCCCCCCc
Q 000175          162 SGTVGPALSSFAPAEKASVLRGEDFPSLQAALPAASGSEK--KQKDGFS---QKQKQGMSQELGNNEQKDGCRFNA  232 (1926)
Q Consensus       162 ~~~~~~~~~~~~~~e~~~vlrgedfpsl~a~~p~~~~~~~--k~~~~~~---qk~k~~~~~~~~~~e~~~~~~~~~  232 (1926)
                      +|.++|-...|..+|+-+       --+|+.|-+++++..  ++-...-   .||-|.+-+.|..-|.+-.+-.++
T Consensus      1193 tGv~gay~s~f~~me~kl-------~~ir~il~~~svs~~~i~~l~~~~~~lr~~l~~~~e~L~~~E~~Lsdi~~~ 1261 (1758)
T KOG0994|consen 1193 TGVLGAYASRFLDMEEKL-------EEIRAILSAPSVSAEDIAQLASATESLRRQLQALTEDLPQEEETLSDITNS 1261 (1758)
T ss_pred             ccCchhhHhHHHHHHHHH-------HHHHHHhcCCCccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhc
Confidence            566666555555554322       124556655666555  2222222   377788888888666665554433


No 53 
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]
Probab=81.76  E-value=2e+02  Score=39.67  Aligned_cols=12  Identities=25%  Similarity=0.155  Sum_probs=5.1

Q ss_pred             CCccccccCCCC
Q 000175          525 DDPFMKDFGSSS  536 (1926)
Q Consensus       525 EDpfmkDfgsS~  536 (1926)
                      +|.|..++...+
T Consensus       311 ~~~~~~~~~~~~  322 (980)
T KOG0980|consen  311 LDLFEAEPASDP  322 (980)
T ss_pred             ccccccCcccCC
Confidence            444444444333


No 54 
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=80.59  E-value=49  Score=44.97  Aligned_cols=40  Identities=28%  Similarity=0.332  Sum_probs=19.3

Q ss_pred             ccccCCCCCCCCCCCCCCC--CCccccccccCCccccccccccccccCC
Q 000175          318 AYWEGDFDMPRPSVLPHKP--AHNVFERWGQRDSETGKVSSSEVARVDP  364 (1926)
Q Consensus       318 ~~w~~~fd~~~~~~~p~k~--~~~~~~~~gqr~~~~~k~~~~e~~~~~~  364 (1926)
                      +-|+++-=.|+--|||--.  --.+|       +|-||+.---+.-||-
T Consensus       752 pvy~eepfvF~KVvLpeLA~lRiavy-------eEggK~ig~RIlpvd~  793 (1189)
T KOG1265|consen  752 PVYEEEPFVFRKVVLPELASLRIAVY-------EEGGKFIGQRILPVDG  793 (1189)
T ss_pred             cccccCCcccceecccchhheeeeee-------ccCCceeeeeccchhc
Confidence            4466553334455777321  11223       3566666555555553


No 55 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=79.26  E-value=79  Score=46.59  Aligned_cols=9  Identities=22%  Similarity=0.298  Sum_probs=4.9

Q ss_pred             CCccccccc
Q 000175          185 DFPSLQAAL  193 (1926)
Q Consensus       185 dfpsl~a~~  193 (1926)
                      ||.-|....
T Consensus       302 ~Y~f~~~~~  310 (1930)
T KOG0161|consen  302 DYKFLSNGE  310 (1930)
T ss_pred             hhhhhcccc
Confidence            555555554


No 56 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=77.98  E-value=5.3  Score=49.80  Aligned_cols=10  Identities=10%  Similarity=-0.054  Sum_probs=5.2

Q ss_pred             CCCCCCCCCC
Q 000175          881 YRGNVHPPYP  890 (1926)
Q Consensus       881 S~~rPfPP~~  890 (1926)
                      +-..|+|.++
T Consensus       443 ss~ppnpaps  452 (506)
T KOG2507|consen  443 SSVPPNPAPS  452 (506)
T ss_pred             ccCCCCCCCc
Confidence            3444555555


No 57 
>PLN02316 synthase/transferase
Probab=77.81  E-value=38  Score=47.08  Aligned_cols=64  Identities=13%  Similarity=0.176  Sum_probs=32.3

Q ss_pred             cccccccCCCC--cccccCCccccCCCCCCCCCCCCCCCCCCcccCCCCCcccccCccccccccc-chhhhcc
Q 000175          769 SWRRDAFESGN--SSTFITQDAENGHYSPRRDSAFGGRAVPRKEFYGGPGIMSSRNYYKAGILEP-HMDEFTV  838 (1926)
Q Consensus       769 SwrR~h~lr~~--sS~F~Pqd~ENg~~SPr~Ds~~ggr~fpr~efyggagFvKKrPY~~gGftD~-hLeDYr~  838 (1926)
                      .|=+..|-|+.  .+.|.|+.+.+.-.   ++-.......|.++|-.-+-|..+.   .|++-|. .-.|||.
T Consensus       510 v~~~g~~NrWth~~~~~~~~~m~~~~~---g~~~~a~v~vP~da~~mdfvFs~~~---~g~~yDn~~~~dyh~  576 (1036)
T PLN02316        510 VWFRGSFNRWTHRLGPLPPQKMVPADN---GSHLKATVKVPLDAYMMDFVFSEKE---EGGIFDNRNGLDYHI  576 (1036)
T ss_pred             EEEEccccCcCCCCCCCCceeeeecCC---CceEEEEEEccccceEEEEEEecCC---CCCCcCCCCCcCCcc
Confidence            34444454454  34577776555431   1111233346777777776776663   3344444 3355553


No 58 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=76.75  E-value=74  Score=42.32  Aligned_cols=12  Identities=8%  Similarity=0.365  Sum_probs=6.9

Q ss_pred             cCCccccccccc
Q 000175          346 QRDSETGKVSSS  357 (1926)
Q Consensus       346 qr~~~~~k~~~~  357 (1926)
                      +|.|+.|+|-..
T Consensus       574 ~~~~~~~~~k~q  585 (1187)
T KOG0579|consen  574 ERANAVSNIKTQ  585 (1187)
T ss_pred             hhhhhhhhhhhh
Confidence            466666666543


No 59 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=74.87  E-value=20  Score=45.67  Aligned_cols=17  Identities=24%  Similarity=0.235  Sum_probs=9.9

Q ss_pred             CCCCCCCcccccccccC
Q 000175           75 PPPLNLPSLRKEHERFD   91 (1926)
Q Consensus        75 p~plnlpslrkeh~~~d   91 (1926)
                      +.||---+-.++||--|
T Consensus        17 s~~l~ed~~~~~~ed~d   33 (708)
T KOG3654|consen   17 SKPLSEDPTKAPVEDPD   33 (708)
T ss_pred             CcccccccccCCcCCCc
Confidence            45555445556777666


No 60 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=74.83  E-value=26  Score=42.15  Aligned_cols=14  Identities=21%  Similarity=0.116  Sum_probs=7.1

Q ss_pred             CCCCCCCCCCcccC
Q 000175          799 SAFGGRAVPRKEFY  812 (1926)
Q Consensus       799 s~~ggr~fpr~efy  812 (1926)
                      ++-=+++|||..|.
T Consensus       250 P~~f~t~fPR~tf~  263 (290)
T KOG2689|consen  250 PYSFHTGFPRVTFT  263 (290)
T ss_pred             CeeeecCCCceecc
Confidence            34445556665443


No 61 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=72.71  E-value=1.6e+02  Score=43.79  Aligned_cols=11  Identities=9%  Similarity=-0.197  Sum_probs=6.3

Q ss_pred             ccCCCCCCCCC
Q 000175          253 RENGGINHDTG  263 (1926)
Q Consensus       253 ~~~~~~~~~~g  263 (1926)
                      +-++-..|...
T Consensus       454 DiaGFEIfe~n  464 (1930)
T KOG0161|consen  454 DIAGFEIFEFN  464 (1930)
T ss_pred             eeccccccCcC
Confidence            55555556554


No 62 
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=72.59  E-value=36  Score=44.15  Aligned_cols=6  Identities=33%  Similarity=0.794  Sum_probs=2.9

Q ss_pred             CCCeee
Q 000175          281 PLPLVR  286 (1926)
Q Consensus       281 plplvr  286 (1926)
                      +.|||-
T Consensus        23 ~~piVI   28 (645)
T KOG0681|consen   23 TIPIVI   28 (645)
T ss_pred             CCcEEE
Confidence            445553


No 63 
>PF06098 Radial_spoke_3:  Radial spoke protein 3;  InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=72.12  E-value=36  Score=41.29  Aligned_cols=10  Identities=10%  Similarity=0.169  Sum_probs=4.8

Q ss_pred             CCCccccccc
Q 000175          336 PAHNVFERWG  345 (1926)
Q Consensus       336 ~~~~~~~~~g  345 (1926)
                      |++-.||+|=
T Consensus         3 ~~NiM~D~RV   12 (291)
T PF06098_consen    3 YGNIMYDRRV   12 (291)
T ss_pred             cccccCCCCc
Confidence            4444555443


No 64 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=72.05  E-value=1.2e+02  Score=38.55  Aligned_cols=10  Identities=30%  Similarity=0.740  Sum_probs=4.7

Q ss_pred             ccccCccccc
Q 000175          838 VSRGQRWNMS  847 (1926)
Q Consensus       838 ~~~~~~Wnip  847 (1926)
                      .....+|-.+
T Consensus       255 ~~~~~rws~~  264 (445)
T PRK13428        255 TAVSQRWSAN  264 (445)
T ss_pred             HHHhCccCcc
Confidence            3344555444


No 65 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=71.88  E-value=34  Score=41.22  Aligned_cols=13  Identities=8%  Similarity=0.015  Sum_probs=7.4

Q ss_pred             cccCCCCCccccc
Q 000175          809 KEFYGGPGIMSSR  821 (1926)
Q Consensus       809 ~efyggagFvKKr  821 (1926)
                      .+|-...+|+++-
T Consensus       249 ~P~~f~t~fPR~t  261 (290)
T KOG2689|consen  249 DPYSFHTGFPRVT  261 (290)
T ss_pred             CCeeeecCCCcee
Confidence            3555566666554


No 66 
>PTZ00491 major vault protein; Provisional
Probab=70.48  E-value=92  Score=42.52  Aligned_cols=9  Identities=44%  Similarity=0.936  Sum_probs=4.9

Q ss_pred             CCcccccCC
Q 000175          150 DGVGVYVPP  158 (1926)
Q Consensus       150 ~~~~~~~~~  158 (1926)
                      .++|.|.|-
T Consensus       145 ~gPGtYlPr  153 (850)
T PTZ00491        145 KGPGTYYPR  153 (850)
T ss_pred             ECCeeecCC
Confidence            445566654


No 67 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=69.77  E-value=1.3e+02  Score=42.19  Aligned_cols=8  Identities=25%  Similarity=0.609  Sum_probs=3.1

Q ss_pred             hhhHhhhc
Q 000175          723 ERMVERIT  730 (1926)
Q Consensus       723 ERmverI~  730 (1926)
                      +++...|+
T Consensus      1741 ~~vl~~I~ 1748 (1758)
T KOG0994|consen 1741 ESVLDHIN 1748 (1758)
T ss_pred             HHHHHHHh
Confidence            33334433


No 68 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=68.97  E-value=2.4e+02  Score=35.73  Aligned_cols=11  Identities=9%  Similarity=-0.055  Sum_probs=5.3

Q ss_pred             cccCCCCcccc
Q 000175          752 FARDNSSGFLD  762 (1926)
Q Consensus       752 TSrd~DSS~~d  762 (1926)
                      -|..+|.++++
T Consensus       409 np~pidp~~le  419 (442)
T PF06637_consen  409 NPPPIDPASLE  419 (442)
T ss_pred             CCCCCChHHHH
Confidence            44455554443


No 69 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=67.54  E-value=9.1  Score=51.48  Aligned_cols=15  Identities=33%  Similarity=0.317  Sum_probs=7.2

Q ss_pred             CCCCCCCCCceEEee
Q 000175           45 ARPTGGGGGGMLVLS   59 (1926)
Q Consensus        45 ~~~~~gg~ggm~vls   59 (1926)
                      +++|+|+|||.-=.|
T Consensus      1217 ~~~Gagvg~GyrGvs 1231 (1282)
T KOG0921|consen 1217 ANYGAGVGNGYRGVS 1231 (1282)
T ss_pred             CCccccccCCCcccc
Confidence            344555555653333


No 70 
>PF10168 Nup88:  Nuclear pore component;  InterPro: IPR019321  Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells []. 
Probab=66.68  E-value=1.2e+02  Score=40.87  Aligned_cols=15  Identities=20%  Similarity=0.441  Sum_probs=7.2

Q ss_pred             CcccccccccCCCCC
Q 000175           81 PSLRKEHERFDSSGS   95 (1926)
Q Consensus        81 pslrkeh~~~d~~~~   95 (1926)
                      |-+--.|-.+-+.|.
T Consensus        83 ~~f~v~~i~~n~~g~   97 (717)
T PF10168_consen   83 PLFEVHQISLNPTGS   97 (717)
T ss_pred             CceeEEEEEECCCCC
Confidence            445555555544443


No 71 
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=66.45  E-value=2.4e+02  Score=39.03  Aligned_cols=19  Identities=16%  Similarity=0.125  Sum_probs=8.5

Q ss_pred             ccccccCCccccccccccc
Q 000175          341 FERWGQRDSETGKVSSSEV  359 (1926)
Q Consensus       341 ~~~~gqr~~~~~k~~~~e~  359 (1926)
                      |-++--++|-.--|+..||
T Consensus       740 ~rtrt~~~n~~npvy~eep  758 (1189)
T KOG1265|consen  740 FRTRTVQGNSFNPVYEEEP  758 (1189)
T ss_pred             hhhccccCCCCCcccccCC
Confidence            4444444554444444443


No 72 
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=65.46  E-value=37  Score=43.44  Aligned_cols=11  Identities=0%  Similarity=-0.254  Sum_probs=7.0

Q ss_pred             CCCCCCCCcCC
Q 000175          500 FPHNDPMHNFS  510 (1926)
Q Consensus       500 ~l~~DP~~~Fg  510 (1926)
                      ++.+++++|..
T Consensus       213 ~l~~~~llw~~  223 (460)
T KOG1363|consen  213 YLRENFLLWGW  223 (460)
T ss_pred             HHhhceeeecc
Confidence            45566777766


No 73 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=64.83  E-value=9  Score=47.92  Aligned_cols=8  Identities=25%  Similarity=0.264  Sum_probs=3.7

Q ss_pred             CCccccCC
Q 000175          785 TQDAENGH  792 (1926)
Q Consensus       785 Pqd~ENg~  792 (1926)
                      -|.+-++.
T Consensus       345 rq~~~i~~  352 (506)
T KOG2507|consen  345 RQNQTIGL  352 (506)
T ss_pred             Hhcccccc
Confidence            34455543


No 74 
>KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms]
Probab=63.36  E-value=3e+02  Score=32.25  Aligned_cols=11  Identities=27%  Similarity=0.782  Sum_probs=4.7

Q ss_pred             ccCcccccccc
Q 000175          469 QYGSEQYNRFR  479 (1926)
Q Consensus       469 ~wGi~qynryr  479 (1926)
                      +|--.+|++|-
T Consensus        71 ~y~r~~FgrYG   81 (225)
T KOG4848|consen   71 AYRRERFGRYG   81 (225)
T ss_pred             HHHHHHHHhhc
Confidence            33334444443


No 75 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=63.27  E-value=1.6e+02  Score=37.24  Aligned_cols=17  Identities=24%  Similarity=0.405  Sum_probs=8.5

Q ss_pred             ccCCCCCCCccccccCCCC
Q 000175          518 KREEPYQDDPFMKDFGSSS  536 (1926)
Q Consensus       518 K~EKpy~EDpfmkDfgsS~  536 (1926)
                      .++++..|.  +++.+.++
T Consensus       138 ~sekqc~eq--Lke~Nksc  154 (442)
T PF06637_consen  138 LSEKQCQEQ--LKEINKSC  154 (442)
T ss_pred             HhHhhhhHH--HHHhhhhH
Confidence            355555553  44444444


No 76 
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]
Probab=62.76  E-value=2.4e+02  Score=36.18  Aligned_cols=6  Identities=50%  Similarity=0.944  Sum_probs=3.2

Q ss_pred             cccccc
Q 000175          527 PFMKDF  532 (1926)
Q Consensus       527 pfmkDf  532 (1926)
                      .|+|||
T Consensus       212 n~~KD~  217 (575)
T KOG4403|consen  212 NWTKDF  217 (575)
T ss_pred             chhhhH
Confidence            455665


No 77 
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=62.36  E-value=3.3e+02  Score=35.17  Aligned_cols=9  Identities=11%  Similarity=0.198  Sum_probs=3.6

Q ss_pred             HHHHhhhhh
Q 000175          549 GVVKKKKDV  557 (1926)
Q Consensus       549 sliKKKKEe  557 (1926)
                      .++++|..+
T Consensus       225 ~flerkv~e  233 (502)
T KOG0982|consen  225 RFLERKVQE  233 (502)
T ss_pred             HHHHHHHHH
Confidence            334444333


No 78 
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=61.60  E-value=4.8e+02  Score=36.05  Aligned_cols=9  Identities=22%  Similarity=0.530  Sum_probs=5.4

Q ss_pred             CcccccCCc
Q 000175          779 NSSTFITQD  787 (1926)
Q Consensus       779 ~sS~F~Pqd  787 (1926)
                      +.-+|+|-+
T Consensus       573 gr~tflpl~  581 (1164)
T TIGR02169       573 GRATFLPLN  581 (1164)
T ss_pred             CCeeeccHh
Confidence            356677743


No 79 
>PRK04863 mukB cell division protein MukB; Provisional
Probab=61.59  E-value=3.9e+02  Score=39.24  Aligned_cols=40  Identities=13%  Similarity=0.296  Sum_probs=17.9

Q ss_pred             hccccc-CcccccCCCCccccccccccc-cccchhhccCCccc
Q 000175          836 FTVSRG-QRWNMSGDGDHYGRNIEMESD-FHENITERYGDVGW  876 (1926)
Q Consensus       836 Yr~~~~-~~WnipgDGD~igRQ~E~dSd-~~~N~~erfGdsgW  876 (1926)
                      |-.+|+ ++.-|.+|-+-|.-. -|+.+ ++.-+.-.|++..|
T Consensus       727 ~L~~~p~d~~li~~~~~~~~~~-~~~~~~~~~~v~~~~~~~~~  768 (1486)
T PRK04863        727 GLEDCPEDLYLIEGDPDSFDDS-VFSVEELEKAVVVKIADRQW  768 (1486)
T ss_pred             hccCCccceeeecCChhHHhcc-CccHHHhcCCeeeeecchhh
Confidence            334455 666665655544332 22222 22222334566556


No 80 
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=60.03  E-value=36  Score=43.52  Aligned_cols=9  Identities=33%  Similarity=0.590  Sum_probs=4.7

Q ss_pred             CCCcccccc
Q 000175          291 SDWADDERD  299 (1926)
Q Consensus       291 sdwadderd  299 (1926)
                      ..|-+|..+
T Consensus        63 ~~~r~~~~~   71 (460)
T KOG1363|consen   63 FNYRDDNVD   71 (460)
T ss_pred             hcccccCCC
Confidence            555555543


No 81 
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=59.82  E-value=4.3e+02  Score=33.96  Aligned_cols=17  Identities=41%  Similarity=0.499  Sum_probs=11.5

Q ss_pred             ccccccCCCCchhhhcc
Q 000175          189 LQAALPAASGSEKKQKD  205 (1926)
Q Consensus       189 l~a~~p~~~~~~~k~~~  205 (1926)
                      |||..|+--+++.|-++
T Consensus        82 lqagtpplqVnEEk~~a   98 (672)
T KOG4722|consen   82 LQAGTPPLQVNEEKEKA   98 (672)
T ss_pred             HhcCCCCCCCchhhccc
Confidence            66777777777666554


No 82 
>PF10168 Nup88:  Nuclear pore component;  InterPro: IPR019321  Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells []. 
Probab=59.63  E-value=1.7e+02  Score=39.61  Aligned_cols=9  Identities=33%  Similarity=1.147  Sum_probs=4.3

Q ss_pred             CCccccccc
Q 000175          449 PWNNSVHSF  457 (1926)
Q Consensus       449 pWn~mmsSf  457 (1926)
                      ||-+.++.|
T Consensus       395 ~wl~~L~~f  403 (717)
T PF10168_consen  395 PWLSALQEF  403 (717)
T ss_pred             ccHHHHHHH
Confidence            354444444


No 83 
>PF05667 DUF812:  Protein of unknown function (DUF812);  InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function.
Probab=59.13  E-value=3.2e+02  Score=36.48  Aligned_cols=9  Identities=56%  Similarity=0.962  Sum_probs=5.2

Q ss_pred             ccccccccC
Q 000175          187 PSLQAALPA  195 (1926)
Q Consensus       187 psl~a~~p~  195 (1926)
                      |++.+.||.
T Consensus        47 p~~~~~l~~   55 (594)
T PF05667_consen   47 PSLGSSLPR   55 (594)
T ss_pred             ccccCCCcc
Confidence            566555555


No 84 
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=58.36  E-value=3.4e+02  Score=39.31  Aligned_cols=6  Identities=50%  Similarity=1.049  Sum_probs=3.0

Q ss_pred             ccCCCC
Q 000175          361 RVDPFG  366 (1926)
Q Consensus       361 ~~~~~~  366 (1926)
                      .+|||+
T Consensus        57 rln~~~   62 (1353)
T TIGR02680        57 RLEPDG   62 (1353)
T ss_pred             ccCCCC
Confidence            445554


No 85 
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=57.14  E-value=5.9e+02  Score=36.10  Aligned_cols=30  Identities=23%  Similarity=0.274  Sum_probs=16.4

Q ss_pred             ccCCCC--CCCCCCcchhhHHHHHhhhhhccc
Q 000175          531 DFGSSS--FDGRDPFSAGLVGVVKKKKDVLKQ  560 (1926)
Q Consensus       531 DfgsS~--~DgrDP~s~~vlsliKKKKEe~Kq  560 (1926)
                      .|.+++  -.|..++.+.++..+.+-++...+
T Consensus       654 V~dP~GtlTGGs~~~~a~~L~~l~~l~~~~~~  685 (1174)
T KOG0933|consen  654 VYDPSGTLTGGSRSKGADLLRQLQKLKQAQKE  685 (1174)
T ss_pred             eeCCCCcccCCCCCCcccHHHHHHHHHHHHHH
Confidence            444444  555556666666665555555443


No 86 
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]
Probab=57.05  E-value=5e+02  Score=33.49  Aligned_cols=23  Identities=17%  Similarity=0.186  Sum_probs=12.2

Q ss_pred             cCCccccCCCCCCCCCCCCCCCC
Q 000175          871 YGDVGWGQGRYRGNVHPPYPDRI  893 (1926)
Q Consensus       871 fGdsgW~qSsS~~rPfPP~~eRm  893 (1926)
                      ||..=.+...+|++..|.+.--|
T Consensus       478 ~g~~llA~r~sH~s~~~t~~~~m  500 (552)
T KOG2129|consen  478 PGHRLLAERRSHGSSPPTVVVQM  500 (552)
T ss_pred             CchhHHHHHHhcCCCCcchhhhh
Confidence            34433445566666666555444


No 87 
>PRK12472 hypothetical protein; Provisional
Probab=57.03  E-value=1.6e+02  Score=38.28  Aligned_cols=12  Identities=25%  Similarity=0.379  Sum_probs=6.7

Q ss_pred             cccccCCCCCCC
Q 000175          908 SRYSMRHPRVLP  919 (1926)
Q Consensus       908 ~rys~rqprvlp  919 (1926)
                      .||.-+||....
T Consensus       480 ~~~~~~~~~~~~  491 (508)
T PRK12472        480 QRYPKPQPANPR  491 (508)
T ss_pred             ccCCCCCCCccc
Confidence            566666665443


No 88 
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=56.83  E-value=4.4e+02  Score=33.95  Aligned_cols=16  Identities=25%  Similarity=0.233  Sum_probs=9.3

Q ss_pred             ccCccCCCcceeeccC
Q 000175          996 TTSRCDSQSSLSVSSA 1011 (1926)
Q Consensus       996 ~t~~~~sqsslsvssp 1011 (1926)
                      ..-+|.|=.+-.|=||
T Consensus       382 ~g~k~asDwtrvvfSp  397 (459)
T KOG0288|consen  382 EGFKCASDWTRVVFSP  397 (459)
T ss_pred             cccccccccceeEECC
Confidence            3455666666666665


No 89 
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=55.04  E-value=5.9e+02  Score=33.03  Aligned_cols=13  Identities=8%  Similarity=0.038  Sum_probs=5.1

Q ss_pred             hHHHHHhhhhhcc
Q 000175          547 LVGVVKKKKDVLK  559 (1926)
Q Consensus       547 vlsliKKKKEe~K  559 (1926)
                      +...+..-+.+..
T Consensus       220 i~~kv~flerkv~  232 (502)
T KOG0982|consen  220 IERKVRFLERKVQ  232 (502)
T ss_pred             HHHHHHHHHHHHH
Confidence            3344443333333


No 90 
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=54.96  E-value=3.1e+02  Score=37.65  Aligned_cols=13  Identities=38%  Similarity=0.580  Sum_probs=9.4

Q ss_pred             CCCCCcccceeee
Q 000175         1534 PRRPRRQRTEFRV 1546 (1926)
Q Consensus      1534 ~r~~~~~rtefrv 1546 (1926)
                      .++.+--|||||-
T Consensus      1197 ~~tvlaeRt~l~c 1209 (1265)
T KOG0976|consen 1197 PHTVLAERTELRC 1209 (1265)
T ss_pred             chhhhhhhhheee
Confidence            3456778999984


No 91 
>PF15359 CDV3:  Carnitine deficiency-associated protein 3
Probab=52.89  E-value=35  Score=37.11  Aligned_cols=63  Identities=29%  Similarity=0.421  Sum_probs=34.0

Q ss_pred             CCCCCCCccccccccccCcccCCCCccCCCCCCCCCcccccCCCCCcCC-CCCCCCCCCccccceeec-cCCCccccccc
Q 000175          116 TGWTKPGTAVGSDQKINDKVDQGPHSVDGLSKGNDGVGVYVPPSVRSGT-VGPALSSFAPAEKASVLR-GEDFPSLQAAL  193 (1926)
Q Consensus       116 ~gw~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~-~~~~~~~~~~~e~~~vlr-gedfpsl~a~~  193 (1926)
                      .=|.|++++.......-  +...       --...++|||.||.+|-.. .-....+      |==|- =+-||||+|+.
T Consensus        59 GPWnk~~~~~~~~~~~~--v~~~-------~~p~~~~gvY~PP~~R~~~~~r~~~qg------aPdI~Se~~FPSL~sta  123 (129)
T PF15359_consen   59 GPWNKSAPAQAPPAPAP--VEEP-------PEPATTSGVYRPPAARNTTTKRKRPQG------APDIFSEEQFPSLQSTA  123 (129)
T ss_pred             CCCcCCCCCCCCCCCCc--cCCC-------CCCCCCCceecCcccccccccCCCCCC------CCCccccccccchHHHh
Confidence            36999887544444432  1111       1135688999999999332 1111111      01111 24799999874


No 92 
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=51.97  E-value=4.7e+02  Score=35.76  Aligned_cols=12  Identities=25%  Similarity=0.288  Sum_probs=9.5

Q ss_pred             cCCCCCCCCCcc
Q 000175          912 MRHPRVLPPPTL  923 (1926)
Q Consensus       912 ~rqprvlppp~~  923 (1926)
                      ||++-|.++|.-
T Consensus       440 ~~~~~~~~~p~~  451 (916)
T KOG0249|consen  440 MDRMGVMTLPSD  451 (916)
T ss_pred             ccCCccccCccc
Confidence            688889998843


No 93 
>KOG3756 consensus Pinin (desmosome-associated protein) [Cytoskeleton]
Probab=51.12  E-value=5.9e+02  Score=31.87  Aligned_cols=14  Identities=14%  Similarity=0.159  Sum_probs=9.0

Q ss_pred             CCCCCccccccccc
Q 000175          376 GREGNMWRASSSLQ  389 (1926)
Q Consensus       376 g~e~nsWr~sspl~  389 (1926)
                      |+.-++|+....+.
T Consensus        53 gr~r~~~~lr~~~~   66 (340)
T KOG3756|consen   53 GRGRGSLLLRRGFS   66 (340)
T ss_pred             cchhhhhhhhhhhh
Confidence            55556777777553


No 94 
>PF05914 RIB43A:  RIB43A;  InterPro: IPR008805 This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [].
Probab=50.67  E-value=6.3e+02  Score=32.07  Aligned_cols=7  Identities=57%  Similarity=0.857  Sum_probs=3.6

Q ss_pred             CCCCCCc
Q 000175          537 FDGRDPF  543 (1926)
Q Consensus       537 ~DgrDP~  543 (1926)
                      |+|-|..
T Consensus       142 F~GEDl~  148 (379)
T PF05914_consen  142 FDGEDLN  148 (379)
T ss_pred             cccccCC
Confidence            5555444


No 95 
>COG4499 Predicted membrane protein [Function unknown]
Probab=50.37  E-value=45  Score=41.86  Aligned_cols=25  Identities=24%  Similarity=0.304  Sum_probs=15.1

Q ss_pred             chhhHHHHHhhhhhcccccccCchh
Q 000175          544 SAGLVGVVKKKKDVLKQTDFHDPVR  568 (1926)
Q Consensus       544 s~~vlsliKKKKEe~Kqae~Ed~lR  568 (1926)
                      ...+.+++++..+.+--.+.-...|
T Consensus       343 d~~~~Al~k~~eevksn~~lsg~~r  367 (434)
T COG4499         343 DLTLLALTKLYEEVKSNTDLSGDKR  367 (434)
T ss_pred             hhHHHHHHHHHHHHhcccCCCchHH
Confidence            3567788887777665455444333


No 96 
>PF12297 EVC2_like:  Ellis van Creveld protein 2 like protein;  InterPro: IPR022076  This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism. 
Probab=49.90  E-value=3.9e+02  Score=34.47  Aligned_cols=6  Identities=17%  Similarity=0.695  Sum_probs=2.2

Q ss_pred             hHhHHH
Q 000175          568 RESFEA  573 (1926)
Q Consensus       568 REE~Ea  573 (1926)
                      .+++.+
T Consensus       212 ~eEy~r  217 (429)
T PF12297_consen  212 QEEYDR  217 (429)
T ss_pred             HHHHHH
Confidence            333333


No 97 
>PRK12472 hypothetical protein; Provisional
Probab=48.90  E-value=3.7e+02  Score=35.25  Aligned_cols=7  Identities=0%  Similarity=-0.368  Sum_probs=3.0

Q ss_pred             cCccccc
Q 000175          470 YGSEQYN  476 (1926)
Q Consensus       470 wGi~qyn  476 (1926)
                      ++|+..+
T Consensus       123 iaIHGt~  129 (508)
T PRK12472        123 IALHGGP  129 (508)
T ss_pred             EEEecCC
Confidence            3444444


No 98 
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=48.61  E-value=8.6e+02  Score=33.84  Aligned_cols=23  Identities=30%  Similarity=0.592  Sum_probs=12.1

Q ss_pred             cCCCCccceEEEeecccCCCCCCCCCCc
Q 000175         1269 GLSQAETPVKLQFGLFSGPSLIPSPFPA 1296 (1926)
Q Consensus      1269 ~~~~~e~pv~lqfglfsgpslipspvpa 1296 (1926)
                      .+.|++-|.++     -||.-|-|--|-
T Consensus       971 sisqprNpsri-----agp~svtslE~m  993 (1265)
T KOG0976|consen  971 SISQPRNPSRI-----AGPKSVTSLEPM  993 (1265)
T ss_pred             EeecCCCchhh-----cCcccccccccc
Confidence            34555555553     466655555443


No 99 
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=48.00  E-value=7.4e+02  Score=32.11  Aligned_cols=18  Identities=17%  Similarity=0.034  Sum_probs=8.8

Q ss_pred             hhhHhhhccCCCCCCCCC
Q 000175          723 ERMVERITTSASSDSSGL  740 (1926)
Q Consensus       723 ERmverI~tSsSsdSs~~  740 (1926)
                      +-+++....|.....-+-
T Consensus       156 d~~v~~~lpS~~~~~ld~  173 (459)
T KOG0288|consen  156 DHFVEDTLPSRALFVLDA  173 (459)
T ss_pred             chhhhcccchhhhhhhhc
Confidence            445555555554443333


No 100
>PF04094 DUF390:  Protein of unknown function (DUF390);  InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice. They have no known function. However they may be some kind of transposable element. There is a putative gypsy type transposon domain (IPR007321 from INTERPRO) towards the N terminus of the proteins.
Probab=47.47  E-value=7.6e+02  Score=33.93  Aligned_cols=11  Identities=27%  Similarity=0.305  Sum_probs=5.6

Q ss_pred             CCCCCCeeecC
Q 000175          278 FPGPLPLVRLK  288 (1926)
Q Consensus       278 ~~gplplvrl~  288 (1926)
                      ++||+|+=++.
T Consensus       320 slgPtpsGdaq  330 (828)
T PF04094_consen  320 SLGPTPSGDAQ  330 (828)
T ss_pred             CCCCCCCCccc
Confidence            35665554443


No 101
>PRK03918 chromosome segregation protein; Provisional
Probab=47.07  E-value=9.1e+02  Score=32.87  Aligned_cols=8  Identities=38%  Similarity=0.563  Sum_probs=5.2

Q ss_pred             Cccccccc
Q 000175          348 DSETGKVS  355 (1926)
Q Consensus       348 ~~~~~k~~  355 (1926)
                      .|-+||.+
T Consensus        31 ~nG~GKSt   38 (880)
T PRK03918         31 QNGSGKSS   38 (880)
T ss_pred             CCCCCHHH
Confidence            36678855


No 102
>PF04094 DUF390:  Protein of unknown function (DUF390);  InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice. They have no known function. However they may be some kind of transposable element. There is a putative gypsy type transposon domain (IPR007321 from INTERPRO) towards the N terminus of the proteins.
Probab=47.01  E-value=7.9e+02  Score=33.81  Aligned_cols=6  Identities=17%  Similarity=0.097  Sum_probs=2.3

Q ss_pred             ccCCcc
Q 000175          745 DMSSRN  750 (1926)
Q Consensus       745 dmvsRV  750 (1926)
                      ..+.|+
T Consensus       691 ragrrv  696 (828)
T PF04094_consen  691 RAGRRV  696 (828)
T ss_pred             hhcccc
Confidence            333333


No 103
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]
Probab=46.43  E-value=4.4e+02  Score=36.31  Aligned_cols=15  Identities=33%  Similarity=0.410  Sum_probs=8.6

Q ss_pred             CCccccCCCCCCCccc
Q 000175           69 VPKLSVPPPLNLPSLR   84 (1926)
Q Consensus        69 ~~klsvp~plnlpslr   84 (1926)
                      --|-|--.|+| |-++
T Consensus       229 elkrSTel~in-PD~~  243 (1424)
T KOG4572|consen  229 ELKRSTELPIN-PDEK  243 (1424)
T ss_pred             hhccccccCCC-CCCc
Confidence            45556666666 5544


No 104
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=46.23  E-value=34  Score=42.24  Aligned_cols=29  Identities=38%  Similarity=0.804  Sum_probs=22.7

Q ss_pred             ccccCCCCCCCcccccccccCCCCCCCCC
Q 000175           71 KLSVPPPLNLPSLRKEHERFDSSGSNGGP   99 (1926)
Q Consensus        71 klsvp~plnlpslrkeh~~~d~~~~~~~~   99 (1926)
                      .-.||||-..||.++-..-||.-|+-||.
T Consensus       310 nE~~ppppempswqqqq~~~~~~ggrggg  338 (465)
T KOG3973|consen  310 NEMVPPPPEMPSWQQQQHTFDRQGGRGGG  338 (465)
T ss_pred             ccCCCCCCCCCcHHHhcCCCCCCCCcCCC
Confidence            34589999999999998888887664443


No 105
>PF07227 DUF1423:  Protein of unknown function (DUF1423);  InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []. Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.
Probab=44.60  E-value=3.7e+02  Score=34.86  Aligned_cols=9  Identities=0%  Similarity=0.290  Sum_probs=3.8

Q ss_pred             ccccccccc
Q 000175          451 NNSVHSFNS  459 (1926)
Q Consensus       451 n~mmsSfs~  459 (1926)
                      ..++..+.+
T Consensus       242 e~al~KL~~  250 (446)
T PF07227_consen  242 EEALAKLEN  250 (446)
T ss_pred             HHHHHHHhC
Confidence            344444444


No 106
>PF04111 APG6:  Autophagy protein Apg6;  InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway [].; GO: 0006914 autophagy; PDB: 3Q8T_A 3VP7_A 4DDP_A.
Probab=44.54  E-value=4.2e+02  Score=32.59  Aligned_cols=6  Identities=17%  Similarity=0.939  Sum_probs=2.3

Q ss_pred             Cchhhh
Q 000175          718 DWEDGE  723 (1926)
Q Consensus       718 DwEd~E  723 (1926)
                      +|.++.
T Consensus       167 ~W~EIN  172 (314)
T PF04111_consen  167 EWNEIN  172 (314)
T ss_dssp             -HHHHH
T ss_pred             ChHHHH
Confidence            455443


No 107
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]
Probab=42.65  E-value=4e+02  Score=33.03  Aligned_cols=12  Identities=17%  Similarity=0.459  Sum_probs=5.6

Q ss_pred             cCcccccccccc
Q 000175          470 YGSEQYNRFRGD  481 (1926)
Q Consensus       470 wGi~qynryrG~  481 (1926)
                      |=++||+-|.+.
T Consensus       121 yidaQFEaYLQE  132 (406)
T KOG3859|consen  121 YIDAQFEAYLQE  132 (406)
T ss_pred             HHHHHHHHHHHH
Confidence            444455544443


No 108
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=42.27  E-value=1.8e+02  Score=37.45  Aligned_cols=20  Identities=45%  Similarity=0.689  Sum_probs=8.6

Q ss_pred             CCCCCCCCCCCCCCCCCCce
Q 000175           36 HSGYYGSNRARPTGGGGGGM   55 (1926)
Q Consensus        36 ~~g~~~~~~~~~~~gg~ggm   55 (1926)
                      ++|+.+...+.+|+++||||
T Consensus        71 ~s~~g~~s~~~gg~~~~~g~   90 (641)
T KOG3915|consen   71 GSGGGGGSSGNGGGGGGGGG   90 (641)
T ss_pred             CCCCCccccCCCCCCCCCCC
Confidence            33333333444444444444


No 109
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=42.10  E-value=1.3e+03  Score=33.72  Aligned_cols=10  Identities=30%  Similarity=0.657  Sum_probs=4.5

Q ss_pred             CCCCCCceee
Q 000175         1319 HPSQPPVFQF 1328 (1926)
Q Consensus      1319 h~s~~plfqf 1328 (1926)
                      |++.+=|++|
T Consensus      1210 ~~~~~~l~~~ 1219 (1317)
T KOG0612|consen 1210 HEFIPFLYHF 1219 (1317)
T ss_pred             CcchHHHhhc
Confidence            4444444444


No 110
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=40.47  E-value=5.1e+02  Score=31.91  Aligned_cols=20  Identities=15%  Similarity=0.298  Sum_probs=9.2

Q ss_pred             CCCcccccccccc-cccCCcc
Q 000175          408 RPSSLNREANKET-KFMSSPF  427 (1926)
Q Consensus       408 rp~S~~R~~~K~s-kY~~sp~  427 (1926)
                      .|.++.-.+.|+. +|++--.
T Consensus        59 ~~~qi~kah~kkv~kyHPDk~   79 (379)
T COG5269          59 IPPQILKAHKKKVYKYHPDKT   79 (379)
T ss_pred             CcHHHHHHHHHHHHHhCccch
Confidence            3334444444444 5555443


No 111
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=40.32  E-value=20  Score=44.10  Aligned_cols=20  Identities=45%  Similarity=0.790  Sum_probs=9.1

Q ss_pred             CCCCCCCCCCCCCCCCCCce
Q 000175           36 HSGYYGSNRARPTGGGGGGM   55 (1926)
Q Consensus        36 ~~g~~~~~~~~~~~gg~ggm   55 (1926)
                      +||+.|..+|.+||||+||+
T Consensus       441 gggr~gggrgrgggggrg~y  460 (465)
T KOG3973|consen  441 GGGRDGGGRGRGGGGGRGGY  460 (465)
T ss_pred             CCCCCCCCCCCCCCCCCccc
Confidence            44444444444444555553


No 112
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=39.38  E-value=1e+03  Score=32.54  Aligned_cols=14  Identities=21%  Similarity=0.074  Sum_probs=6.0

Q ss_pred             CCCccchhHhhhcc
Q 000175          261 DTGSARRSEQVRKQ  274 (1926)
Q Consensus       261 ~~g~~~~~e~~rk~  274 (1926)
                      .+|-.|.-=-.||+
T Consensus       210 SLGITCIELAERkP  223 (948)
T KOG0577|consen  210 SLGITCIELAERKP  223 (948)
T ss_pred             eccchhhhhhhcCC
Confidence            34444533333444


No 113
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=39.35  E-value=1.3e+03  Score=33.57  Aligned_cols=17  Identities=12%  Similarity=-0.142  Sum_probs=8.0

Q ss_pred             CCCcccCCCCCcccccc
Q 000175         1348 SVPYVQPNVPANFSLNQ 1364 (1926)
Q Consensus      1348 ~~~~vq~~~~~~~~~nq 1364 (1926)
                      +++.|+++.+..-.+||
T Consensus      1202 ~~~~v~~~~~~~~~l~~ 1218 (1317)
T KOG0612|consen 1202 PNSLVHKGHEFIPFLYH 1218 (1317)
T ss_pred             chhhcCCCCcchHHHhh
Confidence            44455555544444444


No 114
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=38.93  E-value=1.3e+03  Score=33.00  Aligned_cols=6  Identities=0%  Similarity=-0.009  Sum_probs=2.3

Q ss_pred             CCCCCC
Q 000175          501 PHNDPM  506 (1926)
Q Consensus       501 l~~DP~  506 (1926)
                      +.+-.+
T Consensus       141 V~QG~V  146 (1163)
T COG1196         141 VSQGKV  146 (1163)
T ss_pred             eecccH
Confidence            333333


No 115
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=37.96  E-value=7.3e+02  Score=32.46  Aligned_cols=11  Identities=18%  Similarity=0.513  Sum_probs=8.1

Q ss_pred             CCCCCcccccc
Q 000175          376 GREGNMWRASS  386 (1926)
Q Consensus       376 g~e~nsWr~ss  386 (1926)
                      |...|+|....
T Consensus       235 ~~~~~Lwicli  245 (493)
T KOG0804|consen  235 GCTEDLWICLI  245 (493)
T ss_pred             cccccEEEEEE
Confidence            66778887765


No 116
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]
Probab=37.35  E-value=1.4e+03  Score=32.96  Aligned_cols=16  Identities=31%  Similarity=0.468  Sum_probs=12.3

Q ss_pred             CcccCCCccccccccc
Q 000175          404 GICERPSSLNREANKE  419 (1926)
Q Consensus       404 Gigvrp~S~~R~~~K~  419 (1926)
                      |+|.|++-.+|+++.+
T Consensus        85 glG~rAs~tnRgsslK  100 (1074)
T KOG0250|consen   85 GLGGRASATNRGSSLK  100 (1074)
T ss_pred             hhccccccccchhhHH
Confidence            6667888889988843


No 117
>PLN02316 synthase/transferase
Probab=36.55  E-value=1e+02  Score=43.12  Aligned_cols=24  Identities=13%  Similarity=0.178  Sum_probs=14.9

Q ss_pred             CCCCcccccccccccCCCCccccc
Q 000175         1057 SGNGNMIAPASSISAGDDEEWAVE 1080 (1926)
Q Consensus      1057 ~~~~~~~~~~s~~s~~dd~ew~~~ 1080 (1926)
                      ..|+++..+..+-.++-=--|+-.
T Consensus       499 ~~~t~l~~~~ev~~~g~~NrWth~  522 (1036)
T PLN02316        499 PANTVLNGKPEVWFRGSFNRWTHR  522 (1036)
T ss_pred             CCCCcCCCCceEEEEccccCcCCC
Confidence            556666666666666665667655


No 118
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=36.54  E-value=1.8e+02  Score=37.58  Aligned_cols=8  Identities=50%  Similarity=0.580  Sum_probs=3.7

Q ss_pred             cceeeccC
Q 000175          177 KASVLRGE  184 (1926)
Q Consensus       177 ~~~vlrge  184 (1926)
                      |-|-|||-
T Consensus       178 KmVd~rG~  185 (641)
T KOG3915|consen  178 KMVDLRGA  185 (641)
T ss_pred             eeeeecCc
Confidence            44444544


No 119
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]
Probab=36.44  E-value=1.1e+03  Score=30.61  Aligned_cols=6  Identities=17%  Similarity=0.263  Sum_probs=2.3

Q ss_pred             CCCCCC
Q 000175          936 ECPSPS  941 (1926)
Q Consensus       936 ~~p~ps  941 (1926)
                      -+++|-
T Consensus       490 ~r~~~~  495 (499)
T COG4372         490 PRHAPR  495 (499)
T ss_pred             ccCCcc
Confidence            333333


No 120
>PF12004 DUF3498:  Domain of unknown function (DUF3498);  InterPro: IPR021887  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 433 to 538 amino acids in length. This domain is found associated with PF00616 from PFAM, PF00168 from PFAM. This domain has two conserved sequence motifs: DLQ and PLSFQNP. ; PDB: 3BXJ_B.
Probab=35.15  E-value=13  Score=47.73  Aligned_cols=9  Identities=22%  Similarity=0.730  Sum_probs=0.0

Q ss_pred             HHHHHHHHH
Q 000175          571 FEAELERVQ  579 (1926)
Q Consensus       571 ~EaELEReq  579 (1926)
                      +|+|+..++
T Consensus       374 YEqEI~~Lk  382 (495)
T PF12004_consen  374 YEQEIQSLK  382 (495)
T ss_dssp             ---------
T ss_pred             HHHHHHHHH
Confidence            444444433


No 121
>PF06658 DUF1168:  Protein of unknown function (DUF1168);  InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=32.47  E-value=3.3e+02  Score=30.48  Aligned_cols=17  Identities=29%  Similarity=0.479  Sum_probs=8.5

Q ss_pred             ccccccCCCC-CCCCCCc
Q 000175          527 PFMKDFGSSS-FDGRDPF  543 (1926)
Q Consensus       527 pfmkDfgsS~-~DgrDP~  543 (1926)
                      .|+.+..+|. +-|..-|
T Consensus        21 e~V~NV~GSSAGAGSGeF   38 (142)
T PF06658_consen   21 EFVRNVQGSSAGAGSGEF   38 (142)
T ss_pred             eeeccccccccccCccHH
Confidence            3455544444 6666444


No 122
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=32.39  E-value=7.5e+02  Score=27.62  Aligned_cols=119  Identities=24%  Similarity=0.175  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000175          589 IIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAA  668 (1926)
Q Consensus       589 kEEEqERerEEeRREEEEReRkEREEEErQRReEEErRereErEErER~EaERReEEERKRrEEEERRreEEEERRKEEE  668 (1926)
                      ..+.+.+-.+.....+..+...+...++.+++.++.+++...--+..+.+++...++.+.+.+++..++.+..+...+.+
T Consensus        35 l~~R~~~I~~~l~~A~~~~~ea~~~~~~~~~~l~~Ar~~a~~Ii~~A~~~a~~~~~e~~~~a~~e~~r~~~~a~~~I~~e  114 (161)
T COG0711          35 LDERQAKIADDLAEAERLKEEAQALLAEYEQELEEAREQASEIIEQAKKEAEQIAEEIKAEAEEELERIKEAAEAEIEAE  114 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcchhhhhhhhhchhhc
Q 000175          669 KQKLLELEERIAKRQAEAAKSDSNSSDIADEKSSGLAKE  707 (1926)
Q Consensus       669 EeKRkEEEEe~KKeKaE~EKrekeAeakaEEKakqivkE  707 (1926)
                      +++..+.-........-..-..-............+.+.
T Consensus       115 ~~~a~~~l~~~~~~la~~~aekll~~~~~~~~~~~lid~  153 (161)
T COG0711         115 KERALEELRAEVAELAVAIAEKLLGKKVDEAAQKDLIDA  153 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHH


No 123
>KOG1425 consensus Microfibrillar-associated protein MFAP1 [Cytoskeleton]
Probab=29.63  E-value=5.1e+02  Score=32.89  Aligned_cols=8  Identities=38%  Similarity=0.879  Sum_probs=4.9

Q ss_pred             ccCCCCCC
Q 000175          276 EYFPGPLP  283 (1926)
Q Consensus       276 ~~~~gplp  283 (1926)
                      -|.+|--|
T Consensus        29 ryv~gk~p   36 (430)
T KOG1425|consen   29 RYVSGKAP   36 (430)
T ss_pred             eecCCCCc
Confidence            37777644


No 124
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=29.12  E-value=1.5e+03  Score=32.30  Aligned_cols=15  Identities=20%  Similarity=0.257  Sum_probs=11.1

Q ss_pred             eccceeccccccCCC
Q 000175         1328 FGQLRYTSPVSQGVL 1342 (1926)
Q Consensus      1328 fgqlry~~pi~q~v~ 1342 (1926)
                      |-|.|.-+-|.||-+
T Consensus      1108 ~~qer~er~~Lkg~~ 1122 (1243)
T KOG0971|consen 1108 ISQERHERSILKGAQ 1122 (1243)
T ss_pred             HHHHHHHHHHHhHHH
Confidence            567888877888754


No 125
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=28.95  E-value=1.1e+02  Score=38.75  Aligned_cols=9  Identities=44%  Similarity=0.615  Sum_probs=3.7

Q ss_pred             CCCCccccC
Q 000175          755 DNSSGFLDR  763 (1926)
Q Consensus       755 d~DSS~~dR  763 (1926)
                      ..+|.|.++
T Consensus       414 g~dSg~~~d  422 (506)
T KOG2441|consen  414 GLDSGFADD  422 (506)
T ss_pred             Ccccccccc
Confidence            334444444


No 126
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=27.08  E-value=3.1e+02  Score=35.07  Aligned_cols=7  Identities=43%  Similarity=0.833  Sum_probs=3.2

Q ss_pred             ccccccc
Q 000175          473 EQYNRFR  479 (1926)
Q Consensus       473 ~qynryr  479 (1926)
                      .||=+|.
T Consensus       172 s~YIryt  178 (506)
T KOG2441|consen  172 SQYIRYT  178 (506)
T ss_pred             cceeeec
Confidence            3444444


No 127
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=26.28  E-value=3.1e+02  Score=35.96  Aligned_cols=14  Identities=43%  Similarity=0.534  Sum_probs=6.8

Q ss_pred             cCCCCCCccccccc
Q 000175          374 REGREGNMWRASSS  387 (1926)
Q Consensus       374 r~g~e~nsWr~ssp  387 (1926)
                      |.||+||+-.+.-|
T Consensus       350 R~gr~G~Aivfl~p  363 (567)
T KOG0345|consen  350 RAGREGNAIVFLNP  363 (567)
T ss_pred             hccCccceEEEecc
Confidence            44555555544443


No 128
>PLN03188 kinesin-12 family protein; Provisional
Probab=26.21  E-value=2.3e+03  Score=31.54  Aligned_cols=13  Identities=38%  Similarity=0.560  Sum_probs=6.6

Q ss_pred             CCccccCCCCCCC
Q 000175           69 VPKLSVPPPLNLP   81 (1926)
Q Consensus        69 ~~klsvp~plnlp   81 (1926)
                      .+||-.|-|.+.|
T Consensus        64 ~~~~~sp~p~~pp   76 (1320)
T PLN03188         64 SAKLKSPLPPRPP   76 (1320)
T ss_pred             cccccCCCCCCCC
Confidence            3455555555554


No 129
>PF00901 Orbi_VP5:  Orbivirus outer capsid protein VP5;  InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid. Cryoelectron microscopy indicates that VP5 is a trimer suggesting that there are 360 copies of VP5 per virion [].; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=25.39  E-value=1.7e+03  Score=29.59  Aligned_cols=34  Identities=32%  Similarity=0.548  Sum_probs=14.3

Q ss_pred             CCcchhhHHHHHhhhhhcccccccCchhHhHHHHH
Q 000175          541 DPFSAGLVGVVKKKKDVLKQTDFHDPVRESFEAEL  575 (1926)
Q Consensus       541 DP~s~~vlsliKKKKEe~Kqae~Ed~lREE~EaEL  575 (1926)
                      ||.+..-... ..|-.++++..++++.+.+..+++
T Consensus        80 DPLsPgE~~l-~~Kl~eLE~e~k~d~v~~khn~~I  113 (508)
T PF00901_consen   80 DPLSPGEQGL-QRKLKELEDEQKEDEVREKHNKKI  113 (508)
T ss_pred             CCCCHhHHHH-HHHHHHHHHHHhhHHHHHHHHHHH
Confidence            4444333333 333333343444445555544444


No 130
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=25.12  E-value=2e+03  Score=30.14  Aligned_cols=6  Identities=50%  Similarity=0.855  Sum_probs=2.9

Q ss_pred             CCCCCc
Q 000175          538 DGRDPF  543 (1926)
Q Consensus       538 DgrDP~  543 (1926)
                      ..+|.|
T Consensus       458 rnrdhF  463 (948)
T KOG0577|consen  458 RNRDHF  463 (948)
T ss_pred             hhhhhh
Confidence            335555


No 131
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=25.02  E-value=1.7e+02  Score=42.04  Aligned_cols=13  Identities=15%  Similarity=0.284  Sum_probs=7.0

Q ss_pred             CCCCCcccccccc
Q 000175          376 GREGNMWRASSSL  388 (1926)
Q Consensus       376 g~e~nsWr~sspl  388 (1926)
                      +-+-.+|.++..-
T Consensus      1924 ~~~p~s~~a~~~~ 1936 (2220)
T KOG3598|consen 1924 AAAPTSWNAPIAN 1936 (2220)
T ss_pred             hcCCccccccchh
Confidence            4455666665443


No 132
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]
Probab=24.83  E-value=1.3e+03  Score=30.09  Aligned_cols=142  Identities=18%  Similarity=0.153  Sum_probs=0.0

Q ss_pred             ccccCCCCCCCCCCc----chhhHHHHHhhhhhcccccccCchhHhHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
Q 000175          529 MKDFGSSSFDGRDPF----SAGLVGVVKKKKDVLKQTDFHDPVRESFEAELERVQKMQEQ-ERQRIIEEQERALELARRE  603 (1926)
Q Consensus       529 mkDfgsS~~DgrDP~----s~~vlsliKKKKEe~Kqae~Ed~lREE~EaELEReqReeEE-ERKRkEEEqERerEEeRRE  603 (1926)
                      +.|-.+++.+...|.    ...++..+.++-+..+      ...+.+++=+++.++.... +......|.+...+++++.
T Consensus       122 ~f~i~~~qt~~d~PlC~eC~d~l~~~ld~e~~~~~------~e~~~Y~~~l~~Le~~~~~~~~~~~~~e~~~l~~eE~~L  195 (447)
T KOG2751|consen  122 LFDILSSQTQVDHPLCEECMDVLLNKLDKEVEDAE------DEVDTYKACLQRLEQQNQDVSEEDLLKELKNLKEEEERL  195 (447)
T ss_pred             HHHHhhccCCcccchHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHhhcCcccchHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000175          604 EEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAAKQKLLELE  676 (1926)
Q Consensus       604 EEEReRkEREEEErQRReEEErRereErEErER~EaERReEEERKRrEEEERRreEEEERRKEEEEeKRkEEE  676 (1926)
                      ..+.++.++++++....+.+.+.++.+..+++..-...--.-.+..-+-+......+-++.-.+...+.....
T Consensus       196 ~q~lk~le~~~~~l~~~l~e~~~~~~~~~e~~~~~~~ey~~~~~q~~~~~del~Sle~q~~~s~~qldkL~kt  268 (447)
T KOG2751|consen  196 LQQLEELEKEEAELDHQLKELEFKAERLNEEEDQYWREYNNFQRQLIEHQDELDSLEAQIEYSQAQLDKLRKT  268 (447)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccchHHHHHHHHHHHHHHHHHHHhh


No 133
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=24.59  E-value=2.3e+03  Score=30.67  Aligned_cols=33  Identities=27%  Similarity=0.435  Sum_probs=18.7

Q ss_pred             cccCCCCCCcccccCCCCCCCCCCCCCCCCCcccccccc-CCcccc
Q 000175          308 DRDHGFSKSEAYWEGDFDMPRPSVLPHKPAHNVFERWGQ-RDSETG  352 (1926)
Q Consensus       308 ~r~~g~sk~e~~w~~~fd~~~~~~~p~k~~~~~~~~~gq-r~~~~~  352 (1926)
                      |+..|--+.--|++-            .+++.+|-|.-| |.-|.+
T Consensus        46 GKNnGsVqg~qYF~C------------d~ncG~FVr~sq~r~lEda   79 (1243)
T KOG0971|consen   46 GKNNGSVQGVQYFEC------------DENCGVFVRSSQVRELEDA   79 (1243)
T ss_pred             CCCCCcccceeeEec------------CCCcceEeehhhhHHhhcc
Confidence            455565555566533            145667777766 555553


No 134
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]
Probab=24.50  E-value=1.5e+03  Score=29.70  Aligned_cols=8  Identities=38%  Similarity=0.891  Sum_probs=3.3

Q ss_pred             ccCCCCCC
Q 000175          397 DIGDNRNG  404 (1926)
Q Consensus       397 d~gner~G  404 (1926)
                      .+-|+-+|
T Consensus        76 qmDDD~nG   83 (575)
T KOG4403|consen   76 QMDDDHNG   83 (575)
T ss_pred             hcccccCC
Confidence            34444444


No 135
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=23.54  E-value=60  Score=46.06  Aligned_cols=12  Identities=17%  Similarity=0.332  Sum_probs=5.8

Q ss_pred             ccccCCCCCcCCC
Q 000175          153 GVYVPPSVRSGTV  165 (1926)
Q Consensus       153 ~~~~~~s~~~~~~  165 (1926)
                      ..|+.| .++|++
T Consensus      1772 ~yyL~P-lPlPpe 1783 (2220)
T KOG3598|consen 1772 DYYLAP-LPLPPE 1783 (2220)
T ss_pred             hhhccC-CCCCcc
Confidence            456555 444443


No 136
>KOG2505 consensus Ankyrin repeat protein [General function prediction only]
Probab=23.40  E-value=3.5e+02  Score=35.50  Aligned_cols=7  Identities=29%  Similarity=0.472  Sum_probs=3.1

Q ss_pred             cccCCCC
Q 000175          491 SSFSSGG  497 (1926)
Q Consensus       491 ~sfslG~  497 (1926)
                      ..||.|+
T Consensus       307 ~l~F~~~  313 (591)
T KOG2505|consen  307 NLFFEGD  313 (591)
T ss_pred             ceeecCC
Confidence            3444444


No 137
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=22.39  E-value=1.1e+03  Score=32.70  Aligned_cols=20  Identities=15%  Similarity=0.197  Sum_probs=10.1

Q ss_pred             hcccCCCCCCcccCCCCcee
Q 000175         1487 KSLTGSKAQGLTSGSRGKRY 1506 (1926)
Q Consensus      1487 k~~~~~k~~g~~sg~rg~~y 1506 (1926)
                      +-|-..++-++|.-|+-||+
T Consensus       817 Rq~Le~eF~nLi~~gtdrr~  836 (916)
T KOG0249|consen  817 RQLLEREFNNLLALGTDRRL  836 (916)
T ss_pred             HHHHHHHHHhhhcccccccC
Confidence            33444555555555554443


No 138
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]
Probab=21.93  E-value=2.6e+03  Score=30.45  Aligned_cols=31  Identities=26%  Similarity=0.311  Sum_probs=17.0

Q ss_pred             CCCCCCCCCCCCCCccccccc---cccccCCCCCCC
Q 000175          887 PPYPDRIYPNPETDVISSFGR---SRYSMRHPRVLP  919 (1926)
Q Consensus       887 PP~~eRmYqnse~d~~~~~~r---~rys~rqprvlp  919 (1926)
                      |+.-...|. .|++.+| |+.   -+||+|++|..-
T Consensus       618 p~n~~~ayt-ldg~~~~-~~g~~~~~ySt~~~~~r~  651 (1074)
T KOG0250|consen  618 PANVTKAYT-LDGRQIF-AGGPNYRVYSTRGTRARR  651 (1074)
T ss_pred             Cccceeeec-cCccccc-cCCCCcceeccCCCCCCC
Confidence            333334454 4444442 333   489999987663


No 139
>COG4907 Predicted membrane protein [Function unknown]
Probab=21.58  E-value=64  Score=41.28  Aligned_cols=26  Identities=54%  Similarity=0.966  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCceEEeeccCcccccCCCccccCCCCCCCcccccccccCCCCCCCCCCCCCCCCC
Q 000175           41 GSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEHERFDSSGSNGGPAGGGVSGA  107 (1926)
Q Consensus        41 ~~~~~~~~~gg~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh~~~d~~~~~~~~~~~~~~g~  107 (1926)
                      ++.+++.+|||+||-                                         ||..||||||+
T Consensus       569 ~S~~~~~~GGG~G~~-----------------------------------------gGg~GGGGGGa  594 (595)
T COG4907         569 SSRRSSSSGGGGGFS-----------------------------------------GGGSGGGGGGA  594 (595)
T ss_pred             ccccCCCCCCCCCcC-----------------------------------------CCCCCCCCCCC


No 140
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin  [Chromatin structure and dynamics]
Probab=21.27  E-value=2.9e+02  Score=34.36  Aligned_cols=12  Identities=25%  Similarity=0.207  Sum_probs=6.1

Q ss_pred             CCCCCeeecCCC
Q 000175          279 PGPLPLVRLKPR  290 (1926)
Q Consensus       279 ~gplplvrl~~~  290 (1926)
                      -|+-|+.+|+|-
T Consensus        25 ~g~~~~~h~~y~   36 (410)
T KOG4715|consen   25 GGYNPYTHLAYS   36 (410)
T ss_pred             CCCCcchhhhcc
Confidence            344455555543


No 141
>PF07415 Herpes_LMP2:  Gammaherpesvirus latent membrane protein (LMP2) protein;  InterPro: IPR010881 This family consists of several Gammaherpesvirus latent membrane protein (LMP2) proteins. Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) is a human gammaherpesvirus that infects and establishes latency in B lymphocytes in vivo. The latent membrane protein 2 (LMP2) gene is expressed in latently infected B cells and encodes two protein isoforms, LMP2A and LMP2B, that are identical except for an additional N-terminal 119 aa cytoplasmic domain which is present in the LMP2A isoform. LMP2A is thought to play a key role in either the establishment or the maintenance of latency and/or the reactivation of productive infection from the latent state. The significance of LMP2B and its role in pathogenesis remain unclear [].; GO: 0019042 latent virus infection, 0033644 host cell membrane; PDB: 2JO9_B 1UXW_C.
Probab=20.98  E-value=33  Score=42.33  Aligned_cols=42  Identities=33%  Similarity=0.553  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccC
Q 000175           92 SSGSNGGPAGGGVSGAGQRPGSSGTGWTKPGTAVGSDQKIND  133 (1926)
Q Consensus        92 ~~~~~~~~~~~~~~g~g~~p~~sg~gw~kp~~~~~~~~~~~~  133 (1926)
                      .-+++|||-|+-|+++-.-|+..|.-|..|+.+..++.+.++
T Consensus        13 ~p~~~~~~dg~e~~~~~~~ps~~~~~~~~~~~p~~~d~~~~~   54 (489)
T PF07415_consen   13 PPSPHGGPDGYEGSNNSQYPSSFGSSWNSPGPPNYEDYPSNS   54 (489)
T ss_dssp             ------------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCcccCCCCC
Confidence            345677888899999999999999999999998888887764


Done!