Query 000175
Match_columns 1926
No_of_seqs 391 out of 1543
Neff 3.4
Searched_HMMs 46136
Date Thu Mar 28 21:59:51 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/000175.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/000175hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG0163 Myosin class VI heavy 99.2 1.7E-10 3.8E-15 140.7 12.7 26 838-863 1166-1191(1259)
2 KOG1029 Endocytic adaptor prot 98.8 1E-07 2.2E-12 117.9 18.6 59 647-706 400-458 (1118)
3 PF07001 BAT2_N: BAT2 N-termin 98.5 4.3E-07 9.3E-12 99.8 10.7 67 8-100 16-82 (189)
4 PTZ00121 MAEBL; Provisional 98.4 4.2E-06 9.2E-11 108.8 18.1 9 83-91 604-612 (2084)
5 PTZ00121 MAEBL; Provisional 98.4 5.6E-06 1.2E-10 107.7 17.8 9 318-326 832-840 (2084)
6 KOG1029 Endocytic adaptor prot 98.4 9.8E-06 2.1E-10 101.0 18.0 17 74-91 87-103 (1118)
7 PTZ00266 NIMA-related protein 98.0 7.6E-05 1.6E-09 98.3 15.8 25 933-957 781-805 (1021)
8 PTZ00266 NIMA-related protein 97.9 9.4E-05 2E-09 97.5 15.4 15 52-66 25-39 (1021)
9 KOG4364 Chromatin assembly fac 97.9 0.00031 6.6E-09 87.6 17.2 21 1272-1292 750-770 (811)
10 PRK09510 tolA cell envelope in 97.9 0.00083 1.8E-08 81.2 20.3 7 884-890 363-369 (387)
11 KOG4364 Chromatin assembly fac 97.8 0.00033 7.2E-09 87.3 14.9 8 1299-1306 745-752 (811)
12 COG3064 TolA Membrane protein 97.5 0.0031 6.8E-08 73.9 17.3 6 916-921 365-370 (387)
13 PRK09510 tolA cell envelope in 97.4 0.011 2.4E-07 71.9 20.9 19 903-921 350-368 (387)
14 KOG2891 Surface glycoprotein [ 97.3 0.017 3.6E-07 67.1 18.8 9 388-396 157-165 (445)
15 PF05262 Borrelia_P83: Borreli 97.2 0.011 2.5E-07 73.5 18.2 13 877-889 477-489 (489)
16 TIGR02794 tolA_full TolA prote 97.2 0.023 5E-07 68.4 19.9 12 840-851 287-298 (346)
17 KOG0163 Myosin class VI heavy 97.1 0.0077 1.7E-07 76.2 15.4 32 847-878 1211-1242(1259)
18 KOG2891 Surface glycoprotein [ 97.0 0.035 7.6E-07 64.5 18.4 10 555-564 279-288 (445)
19 KOG1144 Translation initiation 96.9 0.0071 1.5E-07 77.1 13.1 36 1101-1144 707-742 (1064)
20 KOG4661 Hsp27-ERE-TATA-binding 96.8 0.0097 2.1E-07 73.5 11.9 18 322-339 355-372 (940)
21 KOG1144 Translation initiation 96.7 0.0086 1.9E-07 76.4 11.5 12 840-851 474-485 (1064)
22 KOG2072 Translation initiation 96.7 0.29 6.2E-06 63.7 24.0 13 762-774 897-909 (988)
23 KOG4661 Hsp27-ERE-TATA-binding 96.0 0.086 1.9E-06 65.7 14.2 20 236-256 256-275 (940)
24 KOG2412 Nuclear-export-signal 96.0 0.22 4.8E-06 62.5 17.6 35 806-840 420-454 (591)
25 PF13904 DUF4207: Domain of un 96.0 0.21 4.6E-06 58.3 16.6 9 659-667 188-196 (264)
26 KOG2412 Nuclear-export-signal 96.0 0.2 4.2E-06 63.0 16.8 43 817-859 409-456 (591)
27 KOG4722 Zn-finger protein [Gen 95.8 0.2 4.2E-06 61.1 15.2 27 448-476 187-214 (672)
28 KOG0742 AAA+-type ATPase [Post 95.2 1.3 2.7E-05 55.0 19.4 11 722-732 253-263 (630)
29 KOG4817 Unnamed protein [Funct 95.2 0.5 1.1E-05 57.3 15.8 70 277-355 287-375 (468)
30 PF09726 Macoilin: Transmembra 94.9 0.46 9.9E-06 62.2 16.1 9 188-196 196-204 (697)
31 TIGR03319 YmdA_YtgF conserved 94.8 0.72 1.6E-05 58.5 17.0 6 780-785 249-254 (514)
32 PF12037 DUF3523: Domain of un 94.5 4.7 0.0001 48.1 21.2 6 538-543 27-32 (276)
33 KOG2072 Translation initiation 94.4 1.5 3.3E-05 57.5 18.4 10 716-725 742-751 (988)
34 PRK12704 phosphodiesterase; Pr 94.4 1.1 2.4E-05 57.0 17.1 6 780-785 255-260 (520)
35 PF12037 DUF3523: Domain of un 93.8 9.9 0.00021 45.5 21.9 13 545-557 51-63 (276)
36 PRK00106 hypothetical protein; 93.5 1.5 3.3E-05 56.0 16.1 6 780-785 270-275 (535)
37 KOG1103 Predicted coiled-coil 89.0 16 0.00035 44.7 17.0 87 913-1011 399-491 (561)
38 KOG3654 Uncharacterized CH dom 88.2 2.7 5.8E-05 52.9 10.4 20 201-220 115-134 (708)
39 PRK12705 hypothetical protein; 87.3 15 0.00033 47.1 16.5 7 549-555 23-29 (508)
40 PF12128 DUF3584: Protein of u 86.8 26 0.00056 49.1 19.6 6 1229-1234 1168-1173(1201)
41 PRK00409 recombination and DNA 86.5 19 0.00041 48.4 17.5 11 841-851 734-744 (782)
42 PF02029 Caldesmon: Caldesmon; 85.6 3.3 7.1E-05 52.7 9.5 9 876-884 460-468 (492)
43 PF02029 Caldesmon: Caldesmon; 85.3 3.3 7.1E-05 52.7 9.4 12 867-880 426-437 (492)
44 KOG0579 Ste20-like serine/thre 84.6 27 0.00058 46.1 16.4 12 182-193 472-483 (1187)
45 PRK00409 recombination and DNA 84.3 26 0.00057 47.1 17.3 12 277-288 222-233 (782)
46 TIGR01069 mutS2 MutS2 family p 84.2 22 0.00049 47.7 16.6 12 277-288 217-228 (771)
47 PF09731 Mitofilin: Mitochondr 84.1 75 0.0016 41.0 20.6 7 319-325 27-33 (582)
48 KOG1103 Predicted coiled-coil 83.0 34 0.00074 42.0 15.7 9 784-792 351-359 (561)
49 PLN03086 PRLI-interacting fact 83.0 6.5 0.00014 50.9 10.7 12 814-825 183-194 (567)
50 PTZ00491 major vault protein; 82.9 36 0.00078 46.1 17.2 11 150-160 198-208 (850)
51 TIGR01069 mutS2 MutS2 family p 82.8 31 0.00067 46.5 17.0 9 842-850 724-732 (771)
52 KOG0994 Extracellular matrix g 82.2 49 0.0011 46.0 17.8 64 162-232 1193-1261(1758)
53 KOG0980 Actin-binding protein 81.8 2E+02 0.0043 39.7 22.8 12 525-536 311-322 (980)
54 KOG1265 Phospholipase C [Lipid 80.6 49 0.0011 45.0 16.9 40 318-364 752-793 (1189)
55 KOG0161 Myosin class II heavy 79.3 79 0.0017 46.6 19.6 9 185-193 302-310 (1930)
56 KOG2507 Ubiquitin regulatory p 78.0 5.3 0.00012 49.8 7.2 10 881-890 443-452 (506)
57 PLN02316 synthase/transferase 77.8 38 0.00082 47.1 15.5 64 769-838 510-576 (1036)
58 KOG0579 Ste20-like serine/thre 76.8 74 0.0016 42.3 16.5 12 346-357 574-585 (1187)
59 KOG3654 Uncharacterized CH dom 74.9 20 0.00043 45.7 10.9 17 75-91 17-33 (708)
60 KOG2689 Predicted ubiquitin re 74.8 26 0.00056 42.1 11.3 14 799-812 250-263 (290)
61 KOG0161 Myosin class II heavy 72.7 1.6E+02 0.0034 43.8 19.8 11 253-263 454-464 (1930)
62 KOG0681 Actin-related protein 72.6 36 0.00078 44.2 12.4 6 281-286 23-28 (645)
63 PF06098 Radial_spoke_3: Radia 72.1 36 0.00077 41.3 11.8 10 336-345 3-12 (291)
64 PRK13428 F0F1 ATP synthase sub 72.0 1.2E+02 0.0027 38.5 17.0 10 838-847 255-264 (445)
65 KOG2689 Predicted ubiquitin re 71.9 34 0.00073 41.2 11.3 13 809-821 249-261 (290)
66 PTZ00491 major vault protein; 70.5 92 0.002 42.5 15.9 9 150-158 145-153 (850)
67 KOG0994 Extracellular matrix g 69.8 1.3E+02 0.0029 42.2 16.9 8 723-730 1741-1748(1758)
68 PF06637 PV-1: PV-1 protein (P 69.0 2.4E+02 0.0053 35.7 17.7 11 752-762 409-419 (442)
69 KOG0921 Dosage compensation co 67.5 9.1 0.0002 51.5 6.2 15 45-59 1217-1231(1282)
70 PF10168 Nup88: Nuclear pore c 66.7 1.2E+02 0.0027 40.9 16.1 15 81-95 83-97 (717)
71 KOG1265 Phospholipase C [Lipid 66.4 2.4E+02 0.0052 39.0 18.0 19 341-359 740-758 (1189)
72 KOG1363 Predicted regulator of 65.5 37 0.0008 43.4 10.6 11 500-510 213-223 (460)
73 KOG2507 Ubiquitin regulatory p 64.8 9 0.0002 47.9 5.1 8 785-792 345-352 (506)
74 KOG4848 Extracellular matrix-a 63.4 3E+02 0.0065 32.2 17.8 11 469-479 71-81 (225)
75 PF06637 PV-1: PV-1 protein (P 63.3 1.6E+02 0.0034 37.2 14.8 17 518-536 138-154 (442)
76 KOG4403 Cell surface glycoprot 62.8 2.4E+02 0.0053 36.2 16.3 6 527-532 212-217 (575)
77 KOG0982 Centrosomal protein Nu 62.4 3.3E+02 0.007 35.2 17.2 9 549-557 225-233 (502)
78 TIGR02169 SMC_prok_A chromosom 61.6 4.8E+02 0.01 36.0 20.6 9 779-787 573-581 (1164)
79 PRK04863 mukB cell division pr 61.6 3.9E+02 0.0085 39.2 20.2 40 836-876 727-768 (1486)
80 KOG1363 Predicted regulator of 60.0 36 0.00078 43.5 9.2 9 291-299 63-71 (460)
81 KOG4722 Zn-finger protein [Gen 59.8 4.3E+02 0.0093 34.0 17.5 17 189-205 82-98 (672)
82 PF10168 Nup88: Nuclear pore c 59.6 1.7E+02 0.0037 39.6 15.5 9 449-457 395-403 (717)
83 PF05667 DUF812: Protein of un 59.1 3.2E+02 0.0069 36.5 17.5 9 187-195 47-55 (594)
84 TIGR02680 conserved hypothetic 58.4 3.4E+02 0.0074 39.3 18.9 6 361-366 57-62 (1353)
85 KOG0933 Structural maintenance 57.1 5.9E+02 0.013 36.1 19.3 30 531-560 654-685 (1174)
86 KOG2129 Uncharacterized conser 57.1 5E+02 0.011 33.5 17.5 23 871-893 478-500 (552)
87 PRK12472 hypothetical protein; 57.0 1.6E+02 0.0034 38.3 13.8 12 908-919 480-491 (508)
88 KOG0288 WD40 repeat protein Ti 56.8 4.4E+02 0.0096 34.0 17.1 16 996-1011 382-397 (459)
89 KOG0982 Centrosomal protein Nu 55.0 5.9E+02 0.013 33.0 19.1 13 547-559 220-232 (502)
90 KOG0976 Rho/Rac1-interacting s 55.0 3.1E+02 0.0066 37.7 15.9 13 1534-1546 1197-1209(1265)
91 PF15359 CDV3: Carnitine defic 52.9 35 0.00076 37.1 6.5 63 116-193 59-123 (129)
92 KOG0249 LAR-interacting protei 52.0 4.7E+02 0.01 35.8 16.8 12 912-923 440-451 (916)
93 KOG3756 Pinin (desmosome-assoc 51.1 5.9E+02 0.013 31.9 19.5 14 376-389 53-66 (340)
94 PF05914 RIB43A: RIB43A; Inte 50.7 6.3E+02 0.014 32.1 19.4 7 537-543 142-148 (379)
95 COG4499 Predicted membrane pro 50.4 45 0.00097 41.9 7.6 25 544-568 343-367 (434)
96 PF12297 EVC2_like: Ellis van 49.9 3.9E+02 0.0084 34.5 15.3 6 568-573 212-217 (429)
97 PRK12472 hypothetical protein; 48.9 3.7E+02 0.0079 35.2 15.1 7 470-476 123-129 (508)
98 KOG0976 Rho/Rac1-interacting s 48.6 8.6E+02 0.019 33.8 18.4 23 1269-1296 971-993 (1265)
99 KOG0288 WD40 repeat protein Ti 48.0 7.4E+02 0.016 32.1 17.9 18 723-740 156-173 (459)
100 PF04094 DUF390: Protein of un 47.5 7.6E+02 0.017 33.9 17.8 11 278-288 320-330 (828)
101 PRK03918 chromosome segregatio 47.1 9.1E+02 0.02 32.9 20.5 8 348-355 31-38 (880)
102 PF04094 DUF390: Protein of un 47.0 7.9E+02 0.017 33.8 17.8 6 745-750 691-696 (828)
103 KOG4572 Predicted DNA-binding 46.4 4.4E+02 0.0096 36.3 15.4 15 69-84 229-243 (1424)
104 KOG3973 Uncharacterized conser 46.2 34 0.00073 42.2 5.6 29 71-99 310-338 (465)
105 PF07227 DUF1423: Protein of u 44.6 3.7E+02 0.008 34.9 14.1 9 451-459 242-250 (446)
106 PF04111 APG6: Autophagy prote 44.5 4.2E+02 0.0091 32.6 14.4 6 718-723 167-172 (314)
107 KOG3859 Septins (P-loop GTPase 42.6 4E+02 0.0087 33.0 13.4 12 470-481 121-132 (406)
108 KOG3915 Transcription regulato 42.3 1.8E+02 0.0039 37.4 10.9 20 36-55 71-90 (641)
109 KOG0612 Rho-associated, coiled 42.1 1.3E+03 0.028 33.7 19.2 10 1319-1328 1210-1219(1317)
110 COG5269 ZUO1 Ribosome-associat 40.5 5.1E+02 0.011 31.9 13.6 20 408-427 59-79 (379)
111 KOG3973 Uncharacterized conser 40.3 20 0.00043 44.1 2.6 20 36-55 441-460 (465)
112 KOG0577 Serine/threonine prote 39.4 1E+03 0.022 32.5 16.9 14 261-274 210-223 (948)
113 KOG0612 Rho-associated, coiled 39.3 1.3E+03 0.029 33.6 18.8 17 1348-1364 1202-1218(1317)
114 COG1196 Smc Chromosome segrega 38.9 1.3E+03 0.029 33.0 19.7 6 501-506 141-146 (1163)
115 KOG0804 Cytoplasmic Zn-finger 38.0 7.3E+02 0.016 32.5 15.1 11 376-386 235-245 (493)
116 KOG0250 DNA repair protein RAD 37.4 1.4E+03 0.03 33.0 18.5 16 404-419 85-100 (1074)
117 PLN02316 synthase/transferase 36.5 1E+02 0.0022 43.1 8.6 24 1057-1080 499-522 (1036)
118 KOG3915 Transcription regulato 36.5 1.8E+02 0.0038 37.6 9.6 8 177-184 178-185 (641)
119 COG4372 Uncharacterized protei 36.4 1.1E+03 0.023 30.6 19.3 6 936-941 490-495 (499)
120 PF12004 DUF3498: Domain of un 35.1 13 0.00027 47.7 0.0 9 571-579 374-382 (495)
121 PF06658 DUF1168: Protein of u 32.5 3.3E+02 0.0071 30.5 9.9 17 527-543 21-38 (142)
122 COG0711 AtpF F0F1-type ATP syn 32.4 7.5E+02 0.016 27.6 17.2 119 589-707 35-153 (161)
123 KOG1425 Microfibrillar-associa 29.6 5.1E+02 0.011 32.9 11.7 8 276-283 29-36 (430)
124 KOG0971 Microtubule-associated 29.1 1.5E+03 0.032 32.3 16.3 15 1328-1342 1108-1122(1243)
125 KOG2441 mRNA splicing factor/p 29.0 1.1E+02 0.0023 38.8 6.2 9 755-763 414-422 (506)
126 KOG2441 mRNA splicing factor/p 27.1 3.1E+02 0.0066 35.1 9.4 7 473-479 172-178 (506)
127 KOG0345 ATP-dependent RNA heli 26.3 3.1E+02 0.0066 36.0 9.5 14 374-387 350-363 (567)
128 PLN03188 kinesin-12 family pro 26.2 2.3E+03 0.05 31.5 18.0 13 69-81 64-76 (1320)
129 PF00901 Orbi_VP5: Orbivirus o 25.4 1.7E+03 0.037 29.6 18.4 34 541-575 80-113 (508)
130 KOG0577 Serine/threonine prote 25.1 2E+03 0.042 30.1 18.1 6 538-543 458-463 (948)
131 KOG3598 Thyroid hormone recept 25.0 1.7E+02 0.0037 42.0 7.5 13 376-388 1924-1936(2220)
132 KOG2751 Beclin-like protein [S 24.8 1.3E+03 0.029 30.1 14.3 142 529-676 122-268 (447)
133 KOG0971 Microtubule-associated 24.6 2.3E+03 0.049 30.7 19.2 33 308-352 46-79 (1243)
134 KOG4403 Cell surface glycoprot 24.5 1.5E+03 0.033 29.7 14.5 8 397-404 76-83 (575)
135 KOG3598 Thyroid hormone recept 23.5 60 0.0013 46.1 3.1 12 153-165 1772-1783(2220)
136 KOG2505 Ankyrin repeat protein 23.4 3.5E+02 0.0077 35.5 9.3 7 491-497 307-313 (591)
137 KOG0249 LAR-interacting protei 22.4 1.1E+03 0.023 32.7 13.3 20 1487-1506 817-836 (916)
138 KOG0250 DNA repair protein RAD 21.9 2.6E+03 0.056 30.5 19.3 31 887-919 618-651 (1074)
139 COG4907 Predicted membrane pro 21.6 64 0.0014 41.3 2.6 26 41-107 569-594 (595)
140 KOG4715 SWI/SNF-related matrix 21.3 2.9E+02 0.0062 34.4 7.6 12 279-290 25-36 (410)
141 PF07415 Herpes_LMP2: Gammaher 21.0 33 0.00072 42.3 0.1 42 92-133 13-54 (489)
No 1
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=99.15 E-value=1.7e-10 Score=140.71 Aligned_cols=26 Identities=23% Similarity=0.420 Sum_probs=23.6
Q ss_pred ccccCcccccCCCCcccccccccccc
Q 000175 838 VSRGQRWNMSGDGDHYGRNIEMESDF 863 (1926)
Q Consensus 838 ~~~~~~WnipgDGD~igRQ~E~dSd~ 863 (1926)
-.+.++|++||||.||.|||++|++.
T Consensus 1166 ~~k~gmWyaHFdGq~I~RQm~l~~~k 1191 (1259)
T KOG0163|consen 1166 NTKRGMWYAHFDGQWIARQMELHPDK 1191 (1259)
T ss_pred CCccceEEEecCcHHHHhhheecCCC
Confidence 36789999999999999999999875
No 2
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.82 E-value=1e-07 Score=117.87 Aligned_cols=59 Identities=20% Similarity=0.119 Sum_probs=28.1
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcchhhhhhhhhchhh
Q 000175 647 RIAREEERQRIIMEEERRKHAAKQKLLELEERIAKRQAEAAKSDSNSSDIADEKSSGLAK 706 (1926)
Q Consensus 647 RKRrEEEERRreEEEERRKEEEEeKRkEEEEe~KKeKaE~EKrekeAeakaEEKakqivk 706 (1926)
++++|.|++|+.+.|+.|+++...++.++++..-.+++. .+....+......|..++..
T Consensus 400 aar~ElEkqRqlewErar~qem~~Qk~reqe~iv~~nak-~~ql~~eletLn~k~qqls~ 458 (1118)
T KOG1029|consen 400 AAREELEKQRQLEWERARRQEMLNQKNREQEWIVYLNAK-KKQLQQELETLNFKLQQLSG 458 (1118)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHhh
Confidence 334555666666666666655544444444444333322 33333333444444444443
No 3
>PF07001 BAT2_N: BAT2 N-terminus; InterPro: IPR009738 This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2. BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [].
Probab=98.52 E-value=4.3e-07 Score=99.82 Aligned_cols=67 Identities=33% Similarity=0.434 Sum_probs=46.2
Q ss_pred cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeeccCcccccCCCccccCCCCCCCcccccc
Q 000175 8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH 87 (1926)
Q Consensus 8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~gg~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh 87 (1926)
.||.++|||..|--.+.--+ -....-..||.+|++- +.. --||||.||||||.||
T Consensus 16 ~Ky~~l~in~~YkGks~e~q------------------k~~~~~~hGmqsLGKv------~~a-RRmPpPaNLPSLKaEn 70 (189)
T PF07001_consen 16 PKYSSLNINSLYKGKSLEPQ------------------KSTVPRRHGMQSLGKV------PSA-RRMPPPANLPSLKAEN 70 (189)
T ss_pred ccceeechhhhhcCCccccc------------------cCCccCCCcceecccc------ccc-ccCCCCCCCcchhhhc
Confidence 38999999999933332200 0122236799999982 111 2289999999999999
Q ss_pred cccCCCCCCCCCC
Q 000175 88 ERFDSSGSNGGPA 100 (1926)
Q Consensus 88 ~~~d~~~~~~~~~ 100 (1926)
.++|++-.. .|.
T Consensus 71 ~GnDpnv~l-VP~ 82 (189)
T PF07001_consen 71 KGNDPNVSL-VPK 82 (189)
T ss_pred cCCCCCcee-ecC
Confidence 999977666 454
No 4
>PTZ00121 MAEBL; Provisional
Probab=98.44 E-value=4.2e-06 Score=108.77 Aligned_cols=9 Identities=56% Similarity=0.663 Sum_probs=5.6
Q ss_pred ccccccccC
Q 000175 83 LRKEHERFD 91 (1926)
Q Consensus 83 lrkeh~~~d 91 (1926)
--+.-+|||
T Consensus 604 q~~~m~rfd 612 (2084)
T PTZ00121 604 QQKFMERFD 612 (2084)
T ss_pred HHHHHHhcC
Confidence 345666777
No 5
>PTZ00121 MAEBL; Provisional
Probab=98.40 E-value=5.6e-06 Score=107.72 Aligned_cols=9 Identities=33% Similarity=0.545 Sum_probs=5.0
Q ss_pred ccccCCCCC
Q 000175 318 AYWEGDFDM 326 (1926)
Q Consensus 318 ~~w~~~fd~ 326 (1926)
|.|+.+|+-
T Consensus 832 pC~e~~~~N 840 (2084)
T PTZ00121 832 PCLEGSFGN 840 (2084)
T ss_pred ccCCCCCCc
Confidence 556655553
No 6
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.36 E-value=9.8e-06 Score=101.03 Aligned_cols=17 Identities=47% Similarity=0.677 Sum_probs=9.5
Q ss_pred cCCCCCCCcccccccccC
Q 000175 74 VPPPLNLPSLRKEHERFD 91 (1926)
Q Consensus 74 vp~plnlpslrkeh~~~d 91 (1926)
||+-|- |||-|---+|-
T Consensus 87 lP~~LP-Psll~~~~~~~ 103 (1118)
T KOG1029|consen 87 LPPVLP-PSLLKQPPRNA 103 (1118)
T ss_pred CCCCCC-hHHhccCCcCC
Confidence 344333 56777666655
No 7
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.99 E-value=7.6e-05 Score=98.32 Aligned_cols=25 Identities=28% Similarity=0.155 Sum_probs=14.1
Q ss_pred CCCCCCCCCcccccccccccccccc
Q 000175 933 RENECPSPSTFQENEVEYNRLLRSE 957 (1926)
Q Consensus 933 ~~~~~p~ps~f~~~~~~~~~~~r~e 957 (1926)
.++.-|+=++=+--++.|+|.-+..
T Consensus 781 ~~~~~~~~~~~~~~~~~~~~~~~~~ 805 (1021)
T PTZ00266 781 KEAVNPICSAEAHYERVYNHGNRGG 805 (1021)
T ss_pred hhhccchhccCCchhccccCCcccc
Confidence 3455555555455666776665553
No 8
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.94 E-value=9.4e-05 Score=97.50 Aligned_cols=15 Identities=20% Similarity=0.286 Sum_probs=9.2
Q ss_pred CCceEEeeccCcccc
Q 000175 52 GGGMLVLSRPRSSQK 66 (1926)
Q Consensus 52 ~ggm~vlsr~r~~~~ 66 (1926)
+=|.|.|.+.+.+..
T Consensus 25 gFGtVYLAkdk~tg~ 39 (1021)
T PTZ00266 25 RFGEVFLVKHKRTQE 39 (1021)
T ss_pred CCeEEEEEEECCCCe
Confidence 446777777765543
No 9
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.88 E-value=0.00031 Score=87.57 Aligned_cols=21 Identities=29% Similarity=0.199 Sum_probs=12.0
Q ss_pred CCccceEEEeecccCCCCCCC
Q 000175 1272 QAETPVKLQFGLFSGPSLIPS 1292 (1926)
Q Consensus 1272 ~~e~pv~lqfglfsgpslips 1292 (1926)
++-++|+-|+-.-.||+--|.
T Consensus 750 ~~~lqv~~qw~y~l~~~~sp~ 770 (811)
T KOG4364|consen 750 DSRLQVKKQWLYKLGLSPSPD 770 (811)
T ss_pred cccccccceeeeeecCCCCCC
Confidence 355667777666655554333
No 10
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.87 E-value=0.00083 Score=81.21 Aligned_cols=7 Identities=29% Similarity=0.349 Sum_probs=2.9
Q ss_pred CCCCCCC
Q 000175 884 NVHPPYP 890 (1926)
Q Consensus 884 rPfPP~~ 890 (1926)
.+||++|
T Consensus 363 a~lP~pP 369 (387)
T PRK09510 363 AKIPKPP 369 (387)
T ss_pred CCCCCCC
Confidence 3444443
No 11
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.76 E-value=0.00033 Score=87.27 Aligned_cols=8 Identities=13% Similarity=0.111 Sum_probs=3.8
Q ss_pred eccccCcc
Q 000175 1299 IGSIQMPL 1306 (1926)
Q Consensus 1299 igsiqmpl 1306 (1926)
|-+.|.|=
T Consensus 745 l~~Fq~~~ 752 (811)
T KOG4364|consen 745 LSDFQDSR 752 (811)
T ss_pred HHhccccc
Confidence 34555553
No 12
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.52 E-value=0.0031 Score=73.90 Aligned_cols=6 Identities=33% Similarity=1.004 Sum_probs=2.2
Q ss_pred CCCCCC
Q 000175 916 RVLPPP 921 (1926)
Q Consensus 916 rvlppp 921 (1926)
-||+||
T Consensus 365 kiP~pp 370 (387)
T COG3064 365 KIPKPP 370 (387)
T ss_pred cCCCCC
Confidence 333333
No 13
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.41 E-value=0.011 Score=71.91 Aligned_cols=19 Identities=11% Similarity=0.336 Sum_probs=9.5
Q ss_pred ccccccccccCCCCCCCCC
Q 000175 903 SSFGRSRYSMRHPRVLPPP 921 (1926)
Q Consensus 903 ~~~~r~rys~rqprvlppp 921 (1926)
..|||.=.+...-.+||+|
T Consensus 350 ~aldrAA~~Aar~a~lP~p 368 (387)
T PRK09510 350 PALCQAALAAAKTAKIPKP 368 (387)
T ss_pred HHHHHHHHHHHHcCCCCCC
Confidence 4677754444333444444
No 14
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.25 E-value=0.017 Score=67.05 Aligned_cols=9 Identities=11% Similarity=0.021 Sum_probs=5.0
Q ss_pred cccCCcccc
Q 000175 388 LQKDGFGAL 396 (1926)
Q Consensus 388 l~K~w~~a~ 396 (1926)
|+-.||.-.
T Consensus 157 ip~kwf~lk 165 (445)
T KOG2891|consen 157 IPCKWFALK 165 (445)
T ss_pred Ccceeeeec
Confidence 555677543
No 15
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=97.20 E-value=0.011 Score=73.49 Aligned_cols=13 Identities=0% Similarity=-0.010 Sum_probs=7.7
Q ss_pred cCCCCCCCCCCCC
Q 000175 877 GQGRYRGNVHPPY 889 (1926)
Q Consensus 877 ~qSsS~~rPfPP~ 889 (1926)
+.|.-...||.++
T Consensus 477 a~S~~eV~P~T~~ 489 (489)
T PF05262_consen 477 AKSEVEVLPFTSF 489 (489)
T ss_pred hcCccccCCCCCC
Confidence 3566666666653
No 16
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=97.17 E-value=0.023 Score=68.35 Aligned_cols=12 Identities=25% Similarity=0.335 Sum_probs=5.3
Q ss_pred ccCcccccCCCC
Q 000175 840 RGQRWNMSGDGD 851 (1926)
Q Consensus 840 ~~~~WnipgDGD 851 (1926)
|...+.+.-||.
T Consensus 287 v~V~I~L~pdG~ 298 (346)
T TIGR02794 287 CRLRIRLAPDGT 298 (346)
T ss_pred EEEEEEECCCCC
Confidence 334444444453
No 17
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=97.10 E-value=0.0077 Score=76.25 Aligned_cols=32 Identities=22% Similarity=0.177 Sum_probs=27.7
Q ss_pred cCCCCccccccccccccccchhhccCCccccC
Q 000175 847 SGDGDHYGRNIEMESDFHENITERYGDVGWGQ 878 (1926)
Q Consensus 847 pgDGD~igRQ~E~dSd~~~N~~erfGdsgW~q 878 (1926)
...|.+-.|-.|+-++-|+.+|||||+..+.+
T Consensus 1211 eeTgL~rKrGAEI~~~eFe~~W~r~Ggk~~~~ 1242 (1259)
T KOG0163|consen 1211 EETGLTRKRGAEILEHEFEREWERNGGKAYKN 1242 (1259)
T ss_pred HhhccccccccccChHHHHHHHHHhCcHHhHh
Confidence 34677888999999999999999999988876
No 18
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.02 E-value=0.035 Score=64.49 Aligned_cols=10 Identities=10% Similarity=0.132 Sum_probs=3.9
Q ss_pred hhhccccccc
Q 000175 555 KDVLKQTDFH 564 (1926)
Q Consensus 555 KEe~Kqae~E 564 (1926)
.++.++.+.+
T Consensus 279 aeerrqiete 288 (445)
T KOG2891|consen 279 AEERRQIETE 288 (445)
T ss_pred HHHHhhhhHH
Confidence 3333444433
No 19
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.94 E-value=0.0071 Score=77.07 Aligned_cols=36 Identities=25% Similarity=0.238 Sum_probs=18.2
Q ss_pred ccCCCCCcccccchhhhhcccccccCCCCcccceeeeccCceec
Q 000175 1101 EDVPEGDDENIELTQEFEGIHLEEKGSPHMMSNLVLGFNEGVEV 1144 (1926)
Q Consensus 1101 ed~~~~~den~~l~~e~~~~hl~~k~~p~~~~~~vlgf~egv~v 1144 (1926)
.-.|++--.-||.- +.|+-| |+=|-+|||=-.|--|
T Consensus 707 VKvieG~GtTIDVi--LvNG~L------~eGD~IvvcG~~GpIv 742 (1064)
T KOG1144|consen 707 VKVIEGHGTTIDVI--LVNGEL------HEGDQIVVCGLQGPIV 742 (1064)
T ss_pred EEeecCCCceEEEE--EEccee------ccCCEEEEcCCCCchh
Confidence 33444446666653 344333 3446677654445433
No 20
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.75 E-value=0.0097 Score=73.54 Aligned_cols=18 Identities=22% Similarity=0.442 Sum_probs=12.3
Q ss_pred CCCCCCCCCCCCCCCCCc
Q 000175 322 GDFDMPRPSVLPHKPAHN 339 (1926)
Q Consensus 322 ~~fd~~~~~~~p~k~~~~ 339 (1926)
+-|||---.-||+-|.-.
T Consensus 355 rKfdfdAcnevpPapkeS 372 (940)
T KOG4661|consen 355 RKFDFDACNEVPPAPKES 372 (940)
T ss_pred ccccccccccCCCCCccc
Confidence 467887777777665554
No 21
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.73 E-value=0.0086 Score=76.35 Aligned_cols=12 Identities=25% Similarity=0.238 Sum_probs=5.8
Q ss_pred ccCcccccCCCC
Q 000175 840 RGQRWNMSGDGD 851 (1926)
Q Consensus 840 ~~~~WnipgDGD 851 (1926)
+.+..|+-|-.|
T Consensus 474 RSPIcCilGHVD 485 (1064)
T KOG1144|consen 474 RSPICCILGHVD 485 (1064)
T ss_pred CCceEEEeeccc
Confidence 444555555443
No 22
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=96.66 E-value=0.29 Score=63.75 Aligned_cols=13 Identities=38% Similarity=0.654 Sum_probs=9.0
Q ss_pred cCCCCCCcccccc
Q 000175 762 DRGKPFNSWRRDA 774 (1926)
Q Consensus 762 dR~Kp~~SwrR~h 774 (1926)
.|..+.+.|+|.-
T Consensus 897 ~~a~~~~~WrR~a 909 (988)
T KOG2072|consen 897 PRAPEEAEWRRGA 909 (988)
T ss_pred CCCCcchHHhhcc
Confidence 4555677788875
No 23
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.03 E-value=0.086 Score=65.71 Aligned_cols=20 Identities=10% Similarity=-0.019 Sum_probs=12.3
Q ss_pred CCcccccCCCcccCCccccCC
Q 000175 236 GMSPRLQSGQDVVGSRLRENG 256 (1926)
Q Consensus 236 ~m~pq~~~~~~~~g~~~~~~~ 256 (1926)
-..|-+.+-+.+.|.+ ++++
T Consensus 256 eeedlfdSahpeegDl-Dlas 275 (940)
T KOG4661|consen 256 EEEDLFDSAHPEEGDL-DLAS 275 (940)
T ss_pred hccccccccCCccccc-cccc
Confidence 3456666777777775 4443
No 24
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=96.02 E-value=0.22 Score=62.54 Aligned_cols=35 Identities=6% Similarity=-0.080 Sum_probs=29.5
Q ss_pred CCCcccCCCCCcccccCcccccccccchhhhcccc
Q 000175 806 VPRKEFYGGPGIMSSRNYYKAGILEPHMDEFTVSR 840 (1926)
Q Consensus 806 fpr~efyggagFvKKrPY~~gGftD~hLeDYr~~~ 840 (1926)
||+.--...+.+.|+|||..+..++...++|.+.-
T Consensus 420 ~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~m 454 (591)
T KOG2412|consen 420 FPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMM 454 (591)
T ss_pred CchHHHHHHHHHHhcCCccccccccCcHHHHHHhh
Confidence 77777777889999999999999998888887543
No 25
>PF13904 DUF4207: Domain of unknown function (DUF4207)
Probab=95.98 E-value=0.21 Score=58.25 Aligned_cols=9 Identities=22% Similarity=0.250 Sum_probs=3.4
Q ss_pred HHHHHHHHH
Q 000175 659 MEEERRKHA 667 (1926)
Q Consensus 659 EEEERRKEE 667 (1926)
+.++++.++
T Consensus 188 ~W~~kK~~e 196 (264)
T PF13904_consen 188 EWERKKKEE 196 (264)
T ss_pred HHHHHHHHH
Confidence 333333333
No 26
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=95.95 E-value=0.2 Score=62.98 Aligned_cols=43 Identities=5% Similarity=-0.043 Sum_probs=26.4
Q ss_pred cccccCccccccccc---chhhhcccccCcccccCCCC--cccccccc
Q 000175 817 IMSSRNYYKAGILEP---HMDEFTVSRGQRWNMSGDGD--HYGRNIEM 859 (1926)
Q Consensus 817 FvKKrPY~~gGftD~---hLeDYr~~~~~~WnipgDGD--~igRQ~E~ 859 (1926)
|.+.+.|+--.++|- .|+.+++.|+=.-.++.+.+ .+.+.|.+
T Consensus 409 la~V~l~i~~q~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~mGy 456 (591)
T KOG2412|consen 409 LAKVILYIWSQFPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMMGY 456 (591)
T ss_pred HHHHHHHHHHhCchHHHHHHHHHHhcCCccccccccCcHHHHHHhhcc
Confidence 456666666666665 77899999975544444444 44444443
No 27
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=95.76 E-value=0.2 Score=61.05 Aligned_cols=27 Identities=19% Similarity=0.449 Sum_probs=24.0
Q ss_pred CCCcccccccccccccC-CCCcccCccccc
Q 000175 448 QPWNNSVHSFNSQRAER-NPWEQYGSEQYN 476 (1926)
Q Consensus 448 qpWn~mmsSfs~Re~eR-t~~e~wGi~qyn 476 (1926)
..||+.+++|..++.|| ++ +||+.+-+
T Consensus 187 ~dwndvladyea~eswrent--a~gdi~ee 214 (672)
T KOG4722|consen 187 ADWNDVLADYEAEESWRENT--AQGDIHEE 214 (672)
T ss_pred cchhhHHHHHHHHHHHHhcc--hhhhhhcc
Confidence 56999999999999999 66 89998776
No 28
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=95.19 E-value=1.3 Score=55.04 Aligned_cols=11 Identities=36% Similarity=0.534 Sum_probs=5.8
Q ss_pred hhhhHhhhccC
Q 000175 722 GERMVERITTS 732 (1926)
Q Consensus 722 ~ERmverI~tS 732 (1926)
-+..++.|+|.
T Consensus 253 Rekwl~aInTt 263 (630)
T KOG0742|consen 253 REKWLEAINTT 263 (630)
T ss_pred HHHHHHHHhhh
Confidence 34455666655
No 29
>KOG4817 consensus Unnamed protein [Function unknown]
Probab=95.18 E-value=0.5 Score=57.26 Aligned_cols=70 Identities=23% Similarity=0.357 Sum_probs=44.4
Q ss_pred cCCCCCCeeecCCC------------CCCcccccccCCCCccccccCCCCCCcccccCCCCCC-------CCCCCCCCCC
Q 000175 277 YFPGPLPLVRLKPR------------SDWADDERDTGHGITDRDRDHGFSKSEAYWEGDFDMP-------RPSVLPHKPA 337 (1926)
Q Consensus 277 ~~~gplplvrl~~~------------sdwadderdt~~~~~~r~r~~g~sk~e~~w~~~fd~~-------~~~~~p~k~~ 337 (1926)
|.-=+||-||+.++ -||-||+|. ..+.+-||-+.--.|-+...|.| .-+|-|+|--
T Consensus 287 ~~s~~lpQ~r~~~~~~~~q~~~q~~~Qd~~~~~~~-----v~mt~~~~~~~~~~~r~g~~~~~~~s~~~~e~s~~~~~~t 361 (468)
T KOG4817|consen 287 GKSHYLPQVRHAGHQNHHQHQHQQQHQDHHHQQQQ-----VHMTYHHGHGRQRDYRDGSDDVGGGSADLGELSLRPQNDT 361 (468)
T ss_pred ccccccchhcccccchHHHHHHHHhhhhcchhhhh-----hhhhhccCCceeeeccCCccCCCccccccccccccccccc
Confidence 55558899999875 489999984 44556667666666766666666 3355565532
Q ss_pred CccccccccCCccccccc
Q 000175 338 HNVFERWGQRDSETGKVS 355 (1926)
Q Consensus 338 ~~~~~~~gqr~~~~~k~~ 355 (1926)
+ -|-|-..-+.||-
T Consensus 362 ~----~~~~~~~~~~k~~ 375 (468)
T KOG4817|consen 362 A----AWLQQQEKAAKVA 375 (468)
T ss_pred C----CccccCchHHHHH
Confidence 2 2555444454543
No 30
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=94.94 E-value=0.46 Score=62.18 Aligned_cols=9 Identities=56% Similarity=0.693 Sum_probs=5.0
Q ss_pred cccccccCC
Q 000175 188 SLQAALPAA 196 (1926)
Q Consensus 188 sl~a~~p~~ 196 (1926)
.|+-+||+.
T Consensus 196 ~l~~~lp~~ 204 (697)
T PF09726_consen 196 LLQQALPPE 204 (697)
T ss_pred HHHHhCCCc
Confidence 455566554
No 31
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=94.84 E-value=0.72 Score=58.54 Aligned_cols=6 Identities=33% Similarity=0.130 Sum_probs=3.6
Q ss_pred cccccC
Q 000175 780 SSTFIT 785 (1926)
Q Consensus 780 sS~F~P 785 (1926)
-|+|-|
T Consensus 249 ls~fdp 254 (514)
T TIGR03319 249 LSGFDP 254 (514)
T ss_pred ecCCch
Confidence 566655
No 32
>PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif.
Probab=94.47 E-value=4.7 Score=48.08 Aligned_cols=6 Identities=50% Similarity=0.683 Sum_probs=3.3
Q ss_pred CCCCCc
Q 000175 538 DGRDPF 543 (1926)
Q Consensus 538 DgrDP~ 543 (1926)
-++||.
T Consensus 27 ~~FDP~ 32 (276)
T PF12037_consen 27 SGFDPE 32 (276)
T ss_pred CCCCcH
Confidence 355655
No 33
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=94.42 E-value=1.5 Score=57.51 Aligned_cols=10 Identities=40% Similarity=0.308 Sum_probs=3.9
Q ss_pred CCCchhhhhh
Q 000175 716 VGDWEDGERM 725 (1926)
Q Consensus 716 ~dDwEd~ERm 725 (1926)
+.+|....+|
T Consensus 742 vk~k~~l~rm 751 (988)
T KOG2072|consen 742 VKDKKRLSRM 751 (988)
T ss_pred HHHHHHHHHH
Confidence 3344433333
No 34
>PRK12704 phosphodiesterase; Provisional
Probab=94.38 E-value=1.1 Score=57.05 Aligned_cols=6 Identities=33% Similarity=0.130 Sum_probs=3.0
Q ss_pred cccccC
Q 000175 780 SSTFIT 785 (1926)
Q Consensus 780 sS~F~P 785 (1926)
-|+|-|
T Consensus 255 ls~~~~ 260 (520)
T PRK12704 255 LSGFDP 260 (520)
T ss_pred EecCCh
Confidence 445544
No 35
>PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif.
Probab=93.77 E-value=9.9 Score=45.52 Aligned_cols=13 Identities=15% Similarity=0.304 Sum_probs=5.8
Q ss_pred hhhHHHHHhhhhh
Q 000175 545 AGLVGVVKKKKDV 557 (1926)
Q Consensus 545 ~~vlsliKKKKEe 557 (1926)
-.++.+++++++.
T Consensus 51 k~afel~k~QE~T 63 (276)
T PF12037_consen 51 KKAFELMKKQEET 63 (276)
T ss_pred HHHHHHHHHHHHH
Confidence 3344554444333
No 36
>PRK00106 hypothetical protein; Provisional
Probab=93.54 E-value=1.5 Score=55.99 Aligned_cols=6 Identities=33% Similarity=0.130 Sum_probs=3.4
Q ss_pred cccccC
Q 000175 780 SSTFIT 785 (1926)
Q Consensus 780 sS~F~P 785 (1926)
-|+|-|
T Consensus 270 lS~fdp 275 (535)
T PRK00106 270 LSGFDP 275 (535)
T ss_pred EeCCCh
Confidence 555655
No 37
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=89.03 E-value=16 Score=44.69 Aligned_cols=87 Identities=20% Similarity=0.160 Sum_probs=40.0
Q ss_pred CCCCCCCCCccccccCCCCCCCCCCC---CCCccccccccc---ccccccccccccccccccccccCcccccccCCCCCc
Q 000175 913 RHPRVLPPPTLTSMQKPSYRRENECP---SPSTFQENEVEY---NRLLRSESISLAGLDRSEQHNLAQPEIIDVQPESTE 986 (1926)
Q Consensus 913 rqprvlppp~~~~~~~~s~~~~~~~p---~ps~f~~~~~~~---~~~~r~e~t~~~~~~~~~~~~~~~~~~~~~~~~~~~ 986 (1926)
+-||.+|||+.+.+-++| .|.+-.| +-|+....-+-- -.-.-.-+..-++|.++||+...|.-- +
T Consensus 399 gcP~~ie~~VpmPsPl~S-~GsslspS~~ASSSlt~~pcSSPV~~k~llGssaSSp~~qssyqvginqrfh-------a- 469 (561)
T KOG1103|consen 399 GCPRAIEPAVPMPSPLMS-IGSSLSPSLPASSSLTPRPCSSPVKKKPLLGSSASSPAVQSSYQVGINQRFH-------A- 469 (561)
T ss_pred CCCCCCCCCCCCCCcccc-cccccCCCCcccccCCCCCCCCccccccccccccCChhhhhhhhhcchhhhh-------h-
Confidence 457777877776666633 3433222 222111111000 000001123446778888875444221 1
Q ss_pred hhhhcccccccCccCCCcceeeccC
Q 000175 987 NEEQNLERSTTSRCDSQSSLSVSSA 1011 (1926)
Q Consensus 987 ~e~q~~~r~~t~~~~sqsslsvssp 1011 (1926)
-.|++- ++.-.|-|+|.-.|+|
T Consensus 470 -aRhkf~--aqad~dqqasgl~sp~ 491 (561)
T KOG1103|consen 470 -ARHKFA--AQADMDQQASGLNSPA 491 (561)
T ss_pred -ccchhh--hcccCcccccccCCCc
Confidence 123333 4666777777655544
No 38
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=88.16 E-value=2.7 Score=52.85 Aligned_cols=20 Identities=25% Similarity=0.275 Sum_probs=12.0
Q ss_pred hhhcccchhHhhhccccccc
Q 000175 201 KKQKDGFSQKQKQGMSQELG 220 (1926)
Q Consensus 201 ~k~~~~~~qk~k~~~~~~~~ 220 (1926)
+|.-+.+.-||+|.|+.--+
T Consensus 115 kkkmea~fakqrqklgksaf 134 (708)
T KOG3654|consen 115 KKKMEAIFAKQRQKLGKSAF 134 (708)
T ss_pred HHHHHHHHHHHHHHhchhhe
Confidence 34445566677777766544
No 39
>PRK12705 hypothetical protein; Provisional
Probab=87.29 E-value=15 Score=47.14 Aligned_cols=7 Identities=29% Similarity=0.520 Sum_probs=2.8
Q ss_pred HHHHhhh
Q 000175 549 GVVKKKK 555 (1926)
Q Consensus 549 sliKKKK 555 (1926)
.+++++.
T Consensus 23 ~~~~~~~ 29 (508)
T PRK12705 23 VLLKKRQ 29 (508)
T ss_pred HHHHHHH
Confidence 3344443
No 40
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins.
Probab=86.80 E-value=26 Score=49.12 Aligned_cols=6 Identities=33% Similarity=0.534 Sum_probs=2.3
Q ss_pred hccccc
Q 000175 1229 MDHLNA 1234 (1926)
Q Consensus 1229 ~~~~~a 1234 (1926)
++-|+.
T Consensus 1168 ~~~~~~ 1173 (1201)
T PF12128_consen 1168 LDMCNS 1173 (1201)
T ss_pred HHHHHh
Confidence 333333
No 41
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=86.50 E-value=19 Score=48.41 Aligned_cols=11 Identities=27% Similarity=0.570 Sum_probs=6.1
Q ss_pred cCcccccCCCC
Q 000175 841 GQRWNMSGDGD 851 (1926)
Q Consensus 841 ~~~WnipgDGD 851 (1926)
...|=+||-|.
T Consensus 734 ~~v~IIHGkGt 744 (782)
T PRK00409 734 GEVLIIHGKGT 744 (782)
T ss_pred CEEEEEcCCCh
Confidence 44556666553
No 42
>PF02029 Caldesmon: Caldesmon; InterPro: IPR006018 This group of proteins includes two protein families: caldesmon and lymphocyte specific protein. Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart).
Probab=85.59 E-value=3.3 Score=52.71 Aligned_cols=9 Identities=22% Similarity=0.493 Sum_probs=3.7
Q ss_pred ccCCCCCCC
Q 000175 876 WGQGRYRGN 884 (1926)
Q Consensus 876 W~qSsS~~r 884 (1926)
|+.....++
T Consensus 460 w~~~~~e~~ 468 (492)
T PF02029_consen 460 WLTKTPEGS 468 (492)
T ss_pred hhcCCCCCC
Confidence 444444444
No 43
>PF02029 Caldesmon: Caldesmon; InterPro: IPR006018 This group of proteins includes two protein families: caldesmon and lymphocyte specific protein. Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart).
Probab=85.32 E-value=3.3 Score=52.68 Aligned_cols=12 Identities=8% Similarity=0.006 Sum_probs=5.9
Q ss_pred hhhccCCccccCCC
Q 000175 867 ITERYGDVGWGQGR 880 (1926)
Q Consensus 867 ~~erfGdsgW~qSs 880 (1926)
+|| .|--|+++.
T Consensus 426 ~we--~g~v~~~~~ 437 (492)
T PF02029_consen 426 MWE--KGNVFSSSA 437 (492)
T ss_pred hcc--cCCcccCCC
Confidence 455 444555433
No 44
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=84.63 E-value=27 Score=46.06 Aligned_cols=12 Identities=33% Similarity=0.421 Sum_probs=7.1
Q ss_pred ccCCCccccccc
Q 000175 182 RGEDFPSLQAAL 193 (1926)
Q Consensus 182 rgedfpsl~a~~ 193 (1926)
-|+-|-++|++.
T Consensus 472 ~G~~~~s~qs~~ 483 (1187)
T KOG0579|consen 472 QGSTFFSPQSSA 483 (1187)
T ss_pred cCccccCccccC
Confidence 455555666665
No 45
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=84.33 E-value=26 Score=47.11 Aligned_cols=12 Identities=25% Similarity=0.515 Sum_probs=5.4
Q ss_pred cCCCCCCeeecC
Q 000175 277 YFPGPLPLVRLK 288 (1926)
Q Consensus 277 ~~~gplplvrl~ 288 (1926)
+|.-|..+|-|+
T Consensus 222 ~y~ep~~~~~ln 233 (782)
T PRK00409 222 LYIEPQSVVELN 233 (782)
T ss_pred EEEEcHHHHHHH
Confidence 444444455444
No 46
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=84.23 E-value=22 Score=47.70 Aligned_cols=12 Identities=25% Similarity=0.744 Sum_probs=6.3
Q ss_pred cCCCCCCeeecC
Q 000175 277 YFPGPLPLVRLK 288 (1926)
Q Consensus 277 ~~~gplplvrl~ 288 (1926)
+|.-|..+|-||
T Consensus 217 ~~~ep~~~~~ln 228 (771)
T TIGR01069 217 FYIEPQAIVKLN 228 (771)
T ss_pred EEEEcHHHHHHH
Confidence 445555555554
No 47
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=84.13 E-value=75 Score=41.04 Aligned_cols=7 Identities=14% Similarity=0.245 Sum_probs=2.9
Q ss_pred cccCCCC
Q 000175 319 YWEGDFD 325 (1926)
Q Consensus 319 ~w~~~fd 325 (1926)
||++.|+
T Consensus 27 ~~n~~f~ 33 (582)
T PF09731_consen 27 KQNDNFR 33 (582)
T ss_pred hcChHHH
Confidence 3444443
No 48
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=83.04 E-value=34 Score=42.03 Aligned_cols=9 Identities=33% Similarity=0.652 Sum_probs=4.6
Q ss_pred cCCccccCC
Q 000175 784 ITQDAENGH 792 (1926)
Q Consensus 784 ~Pqd~ENg~ 792 (1926)
+|++-.|||
T Consensus 351 ~~~ak~ngh 359 (561)
T KOG1103|consen 351 LPPAKGNGH 359 (561)
T ss_pred CCcccCCCC
Confidence 344555555
No 49
>PLN03086 PRLI-interacting factor K; Provisional
Probab=83.03 E-value=6.5 Score=50.86 Aligned_cols=12 Identities=0% Similarity=-0.415 Sum_probs=6.5
Q ss_pred CCCcccccCccc
Q 000175 814 GPGIMSSRNYYK 825 (1926)
Q Consensus 814 gagFvKKrPY~~ 825 (1926)
...|+|-.|-..
T Consensus 183 kgt~vklqP~~~ 194 (567)
T PLN03086 183 KGTYAKLQPDGV 194 (567)
T ss_pred CCCEEEEeeccC
Confidence 344666665544
No 50
>PTZ00491 major vault protein; Provisional
Probab=82.91 E-value=36 Score=46.12 Aligned_cols=11 Identities=27% Similarity=0.552 Sum_probs=6.1
Q ss_pred CCcccccCCCC
Q 000175 150 DGVGVYVPPSV 160 (1926)
Q Consensus 150 ~~~~~~~~~s~ 160 (1926)
++.|.|+|..-
T Consensus 198 t~~gaylP~v~ 208 (850)
T PTZ00491 198 RTPGAYLPGVF 208 (850)
T ss_pred eccccccCCCc
Confidence 44666666543
No 51
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=82.77 E-value=31 Score=46.45 Aligned_cols=9 Identities=22% Similarity=0.335 Sum_probs=4.5
Q ss_pred CcccccCCC
Q 000175 842 QRWNMSGDG 850 (1926)
Q Consensus 842 ~~WnipgDG 850 (1926)
..+=+||-|
T Consensus 724 ~v~IIHGkG 732 (771)
T TIGR01069 724 VVLIIHGKG 732 (771)
T ss_pred EEEEEcCCC
Confidence 344556644
No 52
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=82.18 E-value=49 Score=45.97 Aligned_cols=64 Identities=25% Similarity=0.294 Sum_probs=35.2
Q ss_pred cCCCCCCCCCCCccccceeeccCCCccccccccCCCCchh--hhcccch---hHhhhccccccccccccCCCCCCc
Q 000175 162 SGTVGPALSSFAPAEKASVLRGEDFPSLQAALPAASGSEK--KQKDGFS---QKQKQGMSQELGNNEQKDGCRFNA 232 (1926)
Q Consensus 162 ~~~~~~~~~~~~~~e~~~vlrgedfpsl~a~~p~~~~~~~--k~~~~~~---qk~k~~~~~~~~~~e~~~~~~~~~ 232 (1926)
+|.++|-...|..+|+-+ --+|+.|-+++++.. ++-...- .||-|.+-+.|..-|.+-.+-.++
T Consensus 1193 tGv~gay~s~f~~me~kl-------~~ir~il~~~svs~~~i~~l~~~~~~lr~~l~~~~e~L~~~E~~Lsdi~~~ 1261 (1758)
T KOG0994|consen 1193 TGVLGAYASRFLDMEEKL-------EEIRAILSAPSVSAEDIAQLASATESLRRQLQALTEDLPQEEETLSDITNS 1261 (1758)
T ss_pred ccCchhhHhHHHHHHHHH-------HHHHHHhcCCCccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhc
Confidence 566666555555554322 124556655666555 2222222 377788888888666665554433
No 53
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]
Probab=81.76 E-value=2e+02 Score=39.67 Aligned_cols=12 Identities=25% Similarity=0.155 Sum_probs=5.1
Q ss_pred CCccccccCCCC
Q 000175 525 DDPFMKDFGSSS 536 (1926)
Q Consensus 525 EDpfmkDfgsS~ 536 (1926)
+|.|..++...+
T Consensus 311 ~~~~~~~~~~~~ 322 (980)
T KOG0980|consen 311 LDLFEAEPASDP 322 (980)
T ss_pred ccccccCcccCC
Confidence 444444444333
No 54
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=80.59 E-value=49 Score=44.97 Aligned_cols=40 Identities=28% Similarity=0.332 Sum_probs=19.3
Q ss_pred ccccCCCCCCCCCCCCCCC--CCccccccccCCccccccccccccccCC
Q 000175 318 AYWEGDFDMPRPSVLPHKP--AHNVFERWGQRDSETGKVSSSEVARVDP 364 (1926)
Q Consensus 318 ~~w~~~fd~~~~~~~p~k~--~~~~~~~~gqr~~~~~k~~~~e~~~~~~ 364 (1926)
+-|+++-=.|+--|||--. --.+| +|-||+.---+.-||-
T Consensus 752 pvy~eepfvF~KVvLpeLA~lRiavy-------eEggK~ig~RIlpvd~ 793 (1189)
T KOG1265|consen 752 PVYEEEPFVFRKVVLPELASLRIAVY-------EEGGKFIGQRILPVDG 793 (1189)
T ss_pred cccccCCcccceecccchhheeeeee-------ccCCceeeeeccchhc
Confidence 4466553334455777321 11223 3566666555555553
No 55
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=79.26 E-value=79 Score=46.59 Aligned_cols=9 Identities=22% Similarity=0.298 Sum_probs=4.9
Q ss_pred CCccccccc
Q 000175 185 DFPSLQAAL 193 (1926)
Q Consensus 185 dfpsl~a~~ 193 (1926)
||.-|....
T Consensus 302 ~Y~f~~~~~ 310 (1930)
T KOG0161|consen 302 DYKFLSNGE 310 (1930)
T ss_pred hhhhhcccc
Confidence 555555554
No 56
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=77.98 E-value=5.3 Score=49.80 Aligned_cols=10 Identities=10% Similarity=-0.054 Sum_probs=5.2
Q ss_pred CCCCCCCCCC
Q 000175 881 YRGNVHPPYP 890 (1926)
Q Consensus 881 S~~rPfPP~~ 890 (1926)
+-..|+|.++
T Consensus 443 ss~ppnpaps 452 (506)
T KOG2507|consen 443 SSVPPNPAPS 452 (506)
T ss_pred ccCCCCCCCc
Confidence 3444555555
No 57
>PLN02316 synthase/transferase
Probab=77.81 E-value=38 Score=47.08 Aligned_cols=64 Identities=13% Similarity=0.176 Sum_probs=32.3
Q ss_pred cccccccCCCC--cccccCCccccCCCCCCCCCCCCCCCCCCcccCCCCCcccccCccccccccc-chhhhcc
Q 000175 769 SWRRDAFESGN--SSTFITQDAENGHYSPRRDSAFGGRAVPRKEFYGGPGIMSSRNYYKAGILEP-HMDEFTV 838 (1926)
Q Consensus 769 SwrR~h~lr~~--sS~F~Pqd~ENg~~SPr~Ds~~ggr~fpr~efyggagFvKKrPY~~gGftD~-hLeDYr~ 838 (1926)
.|=+..|-|+. .+.|.|+.+.+.-. ++-.......|.++|-.-+-|..+. .|++-|. .-.|||.
T Consensus 510 v~~~g~~NrWth~~~~~~~~~m~~~~~---g~~~~a~v~vP~da~~mdfvFs~~~---~g~~yDn~~~~dyh~ 576 (1036)
T PLN02316 510 VWFRGSFNRWTHRLGPLPPQKMVPADN---GSHLKATVKVPLDAYMMDFVFSEKE---EGGIFDNRNGLDYHI 576 (1036)
T ss_pred EEEEccccCcCCCCCCCCceeeeecCC---CceEEEEEEccccceEEEEEEecCC---CCCCcCCCCCcCCcc
Confidence 34444454454 34577776555431 1111233346777777776776663 3344444 3355553
No 58
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=76.75 E-value=74 Score=42.32 Aligned_cols=12 Identities=8% Similarity=0.365 Sum_probs=6.9
Q ss_pred cCCccccccccc
Q 000175 346 QRDSETGKVSSS 357 (1926)
Q Consensus 346 qr~~~~~k~~~~ 357 (1926)
+|.|+.|+|-..
T Consensus 574 ~~~~~~~~~k~q 585 (1187)
T KOG0579|consen 574 ERANAVSNIKTQ 585 (1187)
T ss_pred hhhhhhhhhhhh
Confidence 466666666543
No 59
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=74.87 E-value=20 Score=45.67 Aligned_cols=17 Identities=24% Similarity=0.235 Sum_probs=9.9
Q ss_pred CCCCCCCcccccccccC
Q 000175 75 PPPLNLPSLRKEHERFD 91 (1926)
Q Consensus 75 p~plnlpslrkeh~~~d 91 (1926)
+.||---+-.++||--|
T Consensus 17 s~~l~ed~~~~~~ed~d 33 (708)
T KOG3654|consen 17 SKPLSEDPTKAPVEDPD 33 (708)
T ss_pred CcccccccccCCcCCCc
Confidence 45555445556777666
No 60
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=74.83 E-value=26 Score=42.15 Aligned_cols=14 Identities=21% Similarity=0.116 Sum_probs=7.1
Q ss_pred CCCCCCCCCCcccC
Q 000175 799 SAFGGRAVPRKEFY 812 (1926)
Q Consensus 799 s~~ggr~fpr~efy 812 (1926)
++-=+++|||..|.
T Consensus 250 P~~f~t~fPR~tf~ 263 (290)
T KOG2689|consen 250 PYSFHTGFPRVTFT 263 (290)
T ss_pred CeeeecCCCceecc
Confidence 34445556665443
No 61
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=72.71 E-value=1.6e+02 Score=43.79 Aligned_cols=11 Identities=9% Similarity=-0.197 Sum_probs=6.3
Q ss_pred ccCCCCCCCCC
Q 000175 253 RENGGINHDTG 263 (1926)
Q Consensus 253 ~~~~~~~~~~g 263 (1926)
+-++-..|...
T Consensus 454 DiaGFEIfe~n 464 (1930)
T KOG0161|consen 454 DIAGFEIFEFN 464 (1930)
T ss_pred eeccccccCcC
Confidence 55555556554
No 62
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=72.59 E-value=36 Score=44.15 Aligned_cols=6 Identities=33% Similarity=0.794 Sum_probs=2.9
Q ss_pred CCCeee
Q 000175 281 PLPLVR 286 (1926)
Q Consensus 281 plplvr 286 (1926)
+.|||-
T Consensus 23 ~~piVI 28 (645)
T KOG0681|consen 23 TIPIVI 28 (645)
T ss_pred CCcEEE
Confidence 445553
No 63
>PF06098 Radial_spoke_3: Radial spoke protein 3; InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=72.12 E-value=36 Score=41.29 Aligned_cols=10 Identities=10% Similarity=0.169 Sum_probs=4.8
Q ss_pred CCCccccccc
Q 000175 336 PAHNVFERWG 345 (1926)
Q Consensus 336 ~~~~~~~~~g 345 (1926)
|++-.||+|=
T Consensus 3 ~~NiM~D~RV 12 (291)
T PF06098_consen 3 YGNIMYDRRV 12 (291)
T ss_pred cccccCCCCc
Confidence 4444555443
No 64
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=72.05 E-value=1.2e+02 Score=38.55 Aligned_cols=10 Identities=30% Similarity=0.740 Sum_probs=4.7
Q ss_pred ccccCccccc
Q 000175 838 VSRGQRWNMS 847 (1926)
Q Consensus 838 ~~~~~~Wnip 847 (1926)
.....+|-.+
T Consensus 255 ~~~~~rws~~ 264 (445)
T PRK13428 255 TAVSQRWSAN 264 (445)
T ss_pred HHHhCccCcc
Confidence 3344555444
No 65
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=71.88 E-value=34 Score=41.22 Aligned_cols=13 Identities=8% Similarity=0.015 Sum_probs=7.4
Q ss_pred cccCCCCCccccc
Q 000175 809 KEFYGGPGIMSSR 821 (1926)
Q Consensus 809 ~efyggagFvKKr 821 (1926)
.+|-...+|+++-
T Consensus 249 ~P~~f~t~fPR~t 261 (290)
T KOG2689|consen 249 DPYSFHTGFPRVT 261 (290)
T ss_pred CCeeeecCCCcee
Confidence 3555566666554
No 66
>PTZ00491 major vault protein; Provisional
Probab=70.48 E-value=92 Score=42.52 Aligned_cols=9 Identities=44% Similarity=0.936 Sum_probs=4.9
Q ss_pred CCcccccCC
Q 000175 150 DGVGVYVPP 158 (1926)
Q Consensus 150 ~~~~~~~~~ 158 (1926)
.++|.|.|-
T Consensus 145 ~gPGtYlPr 153 (850)
T PTZ00491 145 KGPGTYYPR 153 (850)
T ss_pred ECCeeecCC
Confidence 445566654
No 67
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=69.77 E-value=1.3e+02 Score=42.19 Aligned_cols=8 Identities=25% Similarity=0.609 Sum_probs=3.1
Q ss_pred hhhHhhhc
Q 000175 723 ERMVERIT 730 (1926)
Q Consensus 723 ERmverI~ 730 (1926)
+++...|+
T Consensus 1741 ~~vl~~I~ 1748 (1758)
T KOG0994|consen 1741 ESVLDHIN 1748 (1758)
T ss_pred HHHHHHHh
Confidence 33334433
No 68
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=68.97 E-value=2.4e+02 Score=35.73 Aligned_cols=11 Identities=9% Similarity=-0.055 Sum_probs=5.3
Q ss_pred cccCCCCcccc
Q 000175 752 FARDNSSGFLD 762 (1926)
Q Consensus 752 TSrd~DSS~~d 762 (1926)
-|..+|.++++
T Consensus 409 np~pidp~~le 419 (442)
T PF06637_consen 409 NPPPIDPASLE 419 (442)
T ss_pred CCCCCChHHHH
Confidence 44455554443
No 69
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=67.54 E-value=9.1 Score=51.48 Aligned_cols=15 Identities=33% Similarity=0.317 Sum_probs=7.2
Q ss_pred CCCCCCCCCceEEee
Q 000175 45 ARPTGGGGGGMLVLS 59 (1926)
Q Consensus 45 ~~~~~gg~ggm~vls 59 (1926)
+++|+|+|||.-=.|
T Consensus 1217 ~~~Gagvg~GyrGvs 1231 (1282)
T KOG0921|consen 1217 ANYGAGVGNGYRGVS 1231 (1282)
T ss_pred CCccccccCCCcccc
Confidence 344555555653333
No 70
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells [].
Probab=66.68 E-value=1.2e+02 Score=40.87 Aligned_cols=15 Identities=20% Similarity=0.441 Sum_probs=7.2
Q ss_pred CcccccccccCCCCC
Q 000175 81 PSLRKEHERFDSSGS 95 (1926)
Q Consensus 81 pslrkeh~~~d~~~~ 95 (1926)
|-+--.|-.+-+.|.
T Consensus 83 ~~f~v~~i~~n~~g~ 97 (717)
T PF10168_consen 83 PLFEVHQISLNPTGS 97 (717)
T ss_pred CceeEEEEEECCCCC
Confidence 445555555544443
No 71
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=66.45 E-value=2.4e+02 Score=39.03 Aligned_cols=19 Identities=16% Similarity=0.125 Sum_probs=8.5
Q ss_pred ccccccCCccccccccccc
Q 000175 341 FERWGQRDSETGKVSSSEV 359 (1926)
Q Consensus 341 ~~~~gqr~~~~~k~~~~e~ 359 (1926)
|-++--++|-.--|+..||
T Consensus 740 ~rtrt~~~n~~npvy~eep 758 (1189)
T KOG1265|consen 740 FRTRTVQGNSFNPVYEEEP 758 (1189)
T ss_pred hhhccccCCCCCcccccCC
Confidence 4444444554444444443
No 72
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=65.46 E-value=37 Score=43.44 Aligned_cols=11 Identities=0% Similarity=-0.254 Sum_probs=7.0
Q ss_pred CCCCCCCCcCC
Q 000175 500 FPHNDPMHNFS 510 (1926)
Q Consensus 500 ~l~~DP~~~Fg 510 (1926)
++.+++++|..
T Consensus 213 ~l~~~~llw~~ 223 (460)
T KOG1363|consen 213 YLRENFLLWGW 223 (460)
T ss_pred HHhhceeeecc
Confidence 45566777766
No 73
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=64.83 E-value=9 Score=47.92 Aligned_cols=8 Identities=25% Similarity=0.264 Sum_probs=3.7
Q ss_pred CCccccCC
Q 000175 785 TQDAENGH 792 (1926)
Q Consensus 785 Pqd~ENg~ 792 (1926)
-|.+-++.
T Consensus 345 rq~~~i~~ 352 (506)
T KOG2507|consen 345 RQNQTIGL 352 (506)
T ss_pred Hhcccccc
Confidence 34455543
No 74
>KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms]
Probab=63.36 E-value=3e+02 Score=32.25 Aligned_cols=11 Identities=27% Similarity=0.782 Sum_probs=4.7
Q ss_pred ccCcccccccc
Q 000175 469 QYGSEQYNRFR 479 (1926)
Q Consensus 469 ~wGi~qynryr 479 (1926)
+|--.+|++|-
T Consensus 71 ~y~r~~FgrYG 81 (225)
T KOG4848|consen 71 AYRRERFGRYG 81 (225)
T ss_pred HHHHHHHHhhc
Confidence 33334444443
No 75
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=63.27 E-value=1.6e+02 Score=37.24 Aligned_cols=17 Identities=24% Similarity=0.405 Sum_probs=8.5
Q ss_pred ccCCCCCCCccccccCCCC
Q 000175 518 KREEPYQDDPFMKDFGSSS 536 (1926)
Q Consensus 518 K~EKpy~EDpfmkDfgsS~ 536 (1926)
.++++..|. +++.+.++
T Consensus 138 ~sekqc~eq--Lke~Nksc 154 (442)
T PF06637_consen 138 LSEKQCQEQ--LKEINKSC 154 (442)
T ss_pred HhHhhhhHH--HHHhhhhH
Confidence 355555553 44444444
No 76
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]
Probab=62.76 E-value=2.4e+02 Score=36.18 Aligned_cols=6 Identities=50% Similarity=0.944 Sum_probs=3.2
Q ss_pred cccccc
Q 000175 527 PFMKDF 532 (1926)
Q Consensus 527 pfmkDf 532 (1926)
.|+|||
T Consensus 212 n~~KD~ 217 (575)
T KOG4403|consen 212 NWTKDF 217 (575)
T ss_pred chhhhH
Confidence 455665
No 77
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=62.36 E-value=3.3e+02 Score=35.17 Aligned_cols=9 Identities=11% Similarity=0.198 Sum_probs=3.6
Q ss_pred HHHHhhhhh
Q 000175 549 GVVKKKKDV 557 (1926)
Q Consensus 549 sliKKKKEe 557 (1926)
.++++|..+
T Consensus 225 ~flerkv~e 233 (502)
T KOG0982|consen 225 RFLERKVQE 233 (502)
T ss_pred HHHHHHHHH
Confidence 334444333
No 78
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=61.60 E-value=4.8e+02 Score=36.05 Aligned_cols=9 Identities=22% Similarity=0.530 Sum_probs=5.4
Q ss_pred CcccccCCc
Q 000175 779 NSSTFITQD 787 (1926)
Q Consensus 779 ~sS~F~Pqd 787 (1926)
+.-+|+|-+
T Consensus 573 gr~tflpl~ 581 (1164)
T TIGR02169 573 GRATFLPLN 581 (1164)
T ss_pred CCeeeccHh
Confidence 356677743
No 79
>PRK04863 mukB cell division protein MukB; Provisional
Probab=61.59 E-value=3.9e+02 Score=39.24 Aligned_cols=40 Identities=13% Similarity=0.296 Sum_probs=17.9
Q ss_pred hccccc-CcccccCCCCccccccccccc-cccchhhccCCccc
Q 000175 836 FTVSRG-QRWNMSGDGDHYGRNIEMESD-FHENITERYGDVGW 876 (1926)
Q Consensus 836 Yr~~~~-~~WnipgDGD~igRQ~E~dSd-~~~N~~erfGdsgW 876 (1926)
|-.+|+ ++.-|.+|-+-|.-. -|+.+ ++.-+.-.|++..|
T Consensus 727 ~L~~~p~d~~li~~~~~~~~~~-~~~~~~~~~~v~~~~~~~~~ 768 (1486)
T PRK04863 727 GLEDCPEDLYLIEGDPDSFDDS-VFSVEELEKAVVVKIADRQW 768 (1486)
T ss_pred hccCCccceeeecCChhHHhcc-CccHHHhcCCeeeeecchhh
Confidence 334455 666665655544332 22222 22222334566556
No 80
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=60.03 E-value=36 Score=43.52 Aligned_cols=9 Identities=33% Similarity=0.590 Sum_probs=4.7
Q ss_pred CCCcccccc
Q 000175 291 SDWADDERD 299 (1926)
Q Consensus 291 sdwadderd 299 (1926)
..|-+|..+
T Consensus 63 ~~~r~~~~~ 71 (460)
T KOG1363|consen 63 FNYRDDNVD 71 (460)
T ss_pred hcccccCCC
Confidence 555555543
No 81
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=59.82 E-value=4.3e+02 Score=33.96 Aligned_cols=17 Identities=41% Similarity=0.499 Sum_probs=11.5
Q ss_pred ccccccCCCCchhhhcc
Q 000175 189 LQAALPAASGSEKKQKD 205 (1926)
Q Consensus 189 l~a~~p~~~~~~~k~~~ 205 (1926)
|||..|+--+++.|-++
T Consensus 82 lqagtpplqVnEEk~~a 98 (672)
T KOG4722|consen 82 LQAGTPPLQVNEEKEKA 98 (672)
T ss_pred HhcCCCCCCCchhhccc
Confidence 66777777777666554
No 82
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells [].
Probab=59.63 E-value=1.7e+02 Score=39.61 Aligned_cols=9 Identities=33% Similarity=1.147 Sum_probs=4.3
Q ss_pred CCccccccc
Q 000175 449 PWNNSVHSF 457 (1926)
Q Consensus 449 pWn~mmsSf 457 (1926)
||-+.++.|
T Consensus 395 ~wl~~L~~f 403 (717)
T PF10168_consen 395 PWLSALQEF 403 (717)
T ss_pred ccHHHHHHH
Confidence 354444444
No 83
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function.
Probab=59.13 E-value=3.2e+02 Score=36.48 Aligned_cols=9 Identities=56% Similarity=0.962 Sum_probs=5.2
Q ss_pred ccccccccC
Q 000175 187 PSLQAALPA 195 (1926)
Q Consensus 187 psl~a~~p~ 195 (1926)
|++.+.||.
T Consensus 47 p~~~~~l~~ 55 (594)
T PF05667_consen 47 PSLGSSLPR 55 (594)
T ss_pred ccccCCCcc
Confidence 566555555
No 84
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=58.36 E-value=3.4e+02 Score=39.31 Aligned_cols=6 Identities=50% Similarity=1.049 Sum_probs=3.0
Q ss_pred ccCCCC
Q 000175 361 RVDPFG 366 (1926)
Q Consensus 361 ~~~~~~ 366 (1926)
.+|||+
T Consensus 57 rln~~~ 62 (1353)
T TIGR02680 57 RLEPDG 62 (1353)
T ss_pred ccCCCC
Confidence 445554
No 85
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=57.14 E-value=5.9e+02 Score=36.10 Aligned_cols=30 Identities=23% Similarity=0.274 Sum_probs=16.4
Q ss_pred ccCCCC--CCCCCCcchhhHHHHHhhhhhccc
Q 000175 531 DFGSSS--FDGRDPFSAGLVGVVKKKKDVLKQ 560 (1926)
Q Consensus 531 DfgsS~--~DgrDP~s~~vlsliKKKKEe~Kq 560 (1926)
.|.+++ -.|..++.+.++..+.+-++...+
T Consensus 654 V~dP~GtlTGGs~~~~a~~L~~l~~l~~~~~~ 685 (1174)
T KOG0933|consen 654 VYDPSGTLTGGSRSKGADLLRQLQKLKQAQKE 685 (1174)
T ss_pred eeCCCCcccCCCCCCcccHHHHHHHHHHHHHH
Confidence 444444 555556666666665555555443
No 86
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]
Probab=57.05 E-value=5e+02 Score=33.49 Aligned_cols=23 Identities=17% Similarity=0.186 Sum_probs=12.2
Q ss_pred cCCccccCCCCCCCCCCCCCCCC
Q 000175 871 YGDVGWGQGRYRGNVHPPYPDRI 893 (1926)
Q Consensus 871 fGdsgW~qSsS~~rPfPP~~eRm 893 (1926)
||..=.+...+|++..|.+.--|
T Consensus 478 ~g~~llA~r~sH~s~~~t~~~~m 500 (552)
T KOG2129|consen 478 PGHRLLAERRSHGSSPPTVVVQM 500 (552)
T ss_pred CchhHHHHHHhcCCCCcchhhhh
Confidence 34433445566666666555444
No 87
>PRK12472 hypothetical protein; Provisional
Probab=57.03 E-value=1.6e+02 Score=38.28 Aligned_cols=12 Identities=25% Similarity=0.379 Sum_probs=6.7
Q ss_pred cccccCCCCCCC
Q 000175 908 SRYSMRHPRVLP 919 (1926)
Q Consensus 908 ~rys~rqprvlp 919 (1926)
.||.-+||....
T Consensus 480 ~~~~~~~~~~~~ 491 (508)
T PRK12472 480 QRYPKPQPANPR 491 (508)
T ss_pred ccCCCCCCCccc
Confidence 566666665443
No 88
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=56.83 E-value=4.4e+02 Score=33.95 Aligned_cols=16 Identities=25% Similarity=0.233 Sum_probs=9.3
Q ss_pred ccCccCCCcceeeccC
Q 000175 996 TTSRCDSQSSLSVSSA 1011 (1926)
Q Consensus 996 ~t~~~~sqsslsvssp 1011 (1926)
..-+|.|=.+-.|=||
T Consensus 382 ~g~k~asDwtrvvfSp 397 (459)
T KOG0288|consen 382 EGFKCASDWTRVVFSP 397 (459)
T ss_pred cccccccccceeEECC
Confidence 3455666666666665
No 89
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=55.04 E-value=5.9e+02 Score=33.03 Aligned_cols=13 Identities=8% Similarity=0.038 Sum_probs=5.1
Q ss_pred hHHHHHhhhhhcc
Q 000175 547 LVGVVKKKKDVLK 559 (1926)
Q Consensus 547 vlsliKKKKEe~K 559 (1926)
+...+..-+.+..
T Consensus 220 i~~kv~flerkv~ 232 (502)
T KOG0982|consen 220 IERKVRFLERKVQ 232 (502)
T ss_pred HHHHHHHHHHHHH
Confidence 3344443333333
No 90
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=54.96 E-value=3.1e+02 Score=37.65 Aligned_cols=13 Identities=38% Similarity=0.580 Sum_probs=9.4
Q ss_pred CCCCCcccceeee
Q 000175 1534 PRRPRRQRTEFRV 1546 (1926)
Q Consensus 1534 ~r~~~~~rtefrv 1546 (1926)
.++.+--|||||-
T Consensus 1197 ~~tvlaeRt~l~c 1209 (1265)
T KOG0976|consen 1197 PHTVLAERTELRC 1209 (1265)
T ss_pred chhhhhhhhheee
Confidence 3456778999984
No 91
>PF15359 CDV3: Carnitine deficiency-associated protein 3
Probab=52.89 E-value=35 Score=37.11 Aligned_cols=63 Identities=29% Similarity=0.421 Sum_probs=34.0
Q ss_pred CCCCCCCccccccccccCcccCCCCccCCCCCCCCCcccccCCCCCcCC-CCCCCCCCCccccceeec-cCCCccccccc
Q 000175 116 TGWTKPGTAVGSDQKINDKVDQGPHSVDGLSKGNDGVGVYVPPSVRSGT-VGPALSSFAPAEKASVLR-GEDFPSLQAAL 193 (1926)
Q Consensus 116 ~gw~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~-~~~~~~~~~~~e~~~vlr-gedfpsl~a~~ 193 (1926)
.=|.|++++.......- +... --...++|||.||.+|-.. .-....+ |==|- =+-||||+|+.
T Consensus 59 GPWnk~~~~~~~~~~~~--v~~~-------~~p~~~~gvY~PP~~R~~~~~r~~~qg------aPdI~Se~~FPSL~sta 123 (129)
T PF15359_consen 59 GPWNKSAPAQAPPAPAP--VEEP-------PEPATTSGVYRPPAARNTTTKRKRPQG------APDIFSEEQFPSLQSTA 123 (129)
T ss_pred CCCcCCCCCCCCCCCCc--cCCC-------CCCCCCCceecCcccccccccCCCCCC------CCCccccccccchHHHh
Confidence 36999887544444432 1111 1135688999999999332 1111111 01111 24799999874
No 92
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=51.97 E-value=4.7e+02 Score=35.76 Aligned_cols=12 Identities=25% Similarity=0.288 Sum_probs=9.5
Q ss_pred cCCCCCCCCCcc
Q 000175 912 MRHPRVLPPPTL 923 (1926)
Q Consensus 912 ~rqprvlppp~~ 923 (1926)
||++-|.++|.-
T Consensus 440 ~~~~~~~~~p~~ 451 (916)
T KOG0249|consen 440 MDRMGVMTLPSD 451 (916)
T ss_pred ccCCccccCccc
Confidence 688889998843
No 93
>KOG3756 consensus Pinin (desmosome-associated protein) [Cytoskeleton]
Probab=51.12 E-value=5.9e+02 Score=31.87 Aligned_cols=14 Identities=14% Similarity=0.159 Sum_probs=9.0
Q ss_pred CCCCCccccccccc
Q 000175 376 GREGNMWRASSSLQ 389 (1926)
Q Consensus 376 g~e~nsWr~sspl~ 389 (1926)
|+.-++|+....+.
T Consensus 53 gr~r~~~~lr~~~~ 66 (340)
T KOG3756|consen 53 GRGRGSLLLRRGFS 66 (340)
T ss_pred cchhhhhhhhhhhh
Confidence 55556777777553
No 94
>PF05914 RIB43A: RIB43A; InterPro: IPR008805 This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [].
Probab=50.67 E-value=6.3e+02 Score=32.07 Aligned_cols=7 Identities=57% Similarity=0.857 Sum_probs=3.6
Q ss_pred CCCCCCc
Q 000175 537 FDGRDPF 543 (1926)
Q Consensus 537 ~DgrDP~ 543 (1926)
|+|-|..
T Consensus 142 F~GEDl~ 148 (379)
T PF05914_consen 142 FDGEDLN 148 (379)
T ss_pred cccccCC
Confidence 5555444
No 95
>COG4499 Predicted membrane protein [Function unknown]
Probab=50.37 E-value=45 Score=41.86 Aligned_cols=25 Identities=24% Similarity=0.304 Sum_probs=15.1
Q ss_pred chhhHHHHHhhhhhcccccccCchh
Q 000175 544 SAGLVGVVKKKKDVLKQTDFHDPVR 568 (1926)
Q Consensus 544 s~~vlsliKKKKEe~Kqae~Ed~lR 568 (1926)
...+.+++++..+.+--.+.-...|
T Consensus 343 d~~~~Al~k~~eevksn~~lsg~~r 367 (434)
T COG4499 343 DLTLLALTKLYEEVKSNTDLSGDKR 367 (434)
T ss_pred hhHHHHHHHHHHHHhcccCCCchHH
Confidence 3567788887777665455444333
No 96
>PF12297 EVC2_like: Ellis van Creveld protein 2 like protein; InterPro: IPR022076 This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism.
Probab=49.90 E-value=3.9e+02 Score=34.47 Aligned_cols=6 Identities=17% Similarity=0.695 Sum_probs=2.2
Q ss_pred hHhHHH
Q 000175 568 RESFEA 573 (1926)
Q Consensus 568 REE~Ea 573 (1926)
.+++.+
T Consensus 212 ~eEy~r 217 (429)
T PF12297_consen 212 QEEYDR 217 (429)
T ss_pred HHHHHH
Confidence 333333
No 97
>PRK12472 hypothetical protein; Provisional
Probab=48.90 E-value=3.7e+02 Score=35.25 Aligned_cols=7 Identities=0% Similarity=-0.368 Sum_probs=3.0
Q ss_pred cCccccc
Q 000175 470 YGSEQYN 476 (1926)
Q Consensus 470 wGi~qyn 476 (1926)
++|+..+
T Consensus 123 iaIHGt~ 129 (508)
T PRK12472 123 IALHGGP 129 (508)
T ss_pred EEEecCC
Confidence 3444444
No 98
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=48.61 E-value=8.6e+02 Score=33.84 Aligned_cols=23 Identities=30% Similarity=0.592 Sum_probs=12.1
Q ss_pred cCCCCccceEEEeecccCCCCCCCCCCc
Q 000175 1269 GLSQAETPVKLQFGLFSGPSLIPSPFPA 1296 (1926)
Q Consensus 1269 ~~~~~e~pv~lqfglfsgpslipspvpa 1296 (1926)
.+.|++-|.++ -||.-|-|--|-
T Consensus 971 sisqprNpsri-----agp~svtslE~m 993 (1265)
T KOG0976|consen 971 SISQPRNPSRI-----AGPKSVTSLEPM 993 (1265)
T ss_pred EeecCCCchhh-----cCcccccccccc
Confidence 34555555553 466655555443
No 99
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=48.00 E-value=7.4e+02 Score=32.11 Aligned_cols=18 Identities=17% Similarity=0.034 Sum_probs=8.8
Q ss_pred hhhHhhhccCCCCCCCCC
Q 000175 723 ERMVERITTSASSDSSGL 740 (1926)
Q Consensus 723 ERmverI~tSsSsdSs~~ 740 (1926)
+-+++....|.....-+-
T Consensus 156 d~~v~~~lpS~~~~~ld~ 173 (459)
T KOG0288|consen 156 DHFVEDTLPSRALFVLDA 173 (459)
T ss_pred chhhhcccchhhhhhhhc
Confidence 445555555554443333
No 100
>PF04094 DUF390: Protein of unknown function (DUF390); InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice. They have no known function. However they may be some kind of transposable element. There is a putative gypsy type transposon domain (IPR007321 from INTERPRO) towards the N terminus of the proteins.
Probab=47.47 E-value=7.6e+02 Score=33.93 Aligned_cols=11 Identities=27% Similarity=0.305 Sum_probs=5.6
Q ss_pred CCCCCCeeecC
Q 000175 278 FPGPLPLVRLK 288 (1926)
Q Consensus 278 ~~gplplvrl~ 288 (1926)
++||+|+=++.
T Consensus 320 slgPtpsGdaq 330 (828)
T PF04094_consen 320 SLGPTPSGDAQ 330 (828)
T ss_pred CCCCCCCCccc
Confidence 35665554443
No 101
>PRK03918 chromosome segregation protein; Provisional
Probab=47.07 E-value=9.1e+02 Score=32.87 Aligned_cols=8 Identities=38% Similarity=0.563 Sum_probs=5.2
Q ss_pred Cccccccc
Q 000175 348 DSETGKVS 355 (1926)
Q Consensus 348 ~~~~~k~~ 355 (1926)
.|-+||.+
T Consensus 31 ~nG~GKSt 38 (880)
T PRK03918 31 QNGSGKSS 38 (880)
T ss_pred CCCCCHHH
Confidence 36678855
No 102
>PF04094 DUF390: Protein of unknown function (DUF390); InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice. They have no known function. However they may be some kind of transposable element. There is a putative gypsy type transposon domain (IPR007321 from INTERPRO) towards the N terminus of the proteins.
Probab=47.01 E-value=7.9e+02 Score=33.81 Aligned_cols=6 Identities=17% Similarity=0.097 Sum_probs=2.3
Q ss_pred ccCCcc
Q 000175 745 DMSSRN 750 (1926)
Q Consensus 745 dmvsRV 750 (1926)
..+.|+
T Consensus 691 ragrrv 696 (828)
T PF04094_consen 691 RAGRRV 696 (828)
T ss_pred hhcccc
Confidence 333333
No 103
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]
Probab=46.43 E-value=4.4e+02 Score=36.31 Aligned_cols=15 Identities=33% Similarity=0.410 Sum_probs=8.6
Q ss_pred CCccccCCCCCCCccc
Q 000175 69 VPKLSVPPPLNLPSLR 84 (1926)
Q Consensus 69 ~~klsvp~plnlpslr 84 (1926)
--|-|--.|+| |-++
T Consensus 229 elkrSTel~in-PD~~ 243 (1424)
T KOG4572|consen 229 ELKRSTELPIN-PDEK 243 (1424)
T ss_pred hhccccccCCC-CCCc
Confidence 45556666666 5544
No 104
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=46.23 E-value=34 Score=42.24 Aligned_cols=29 Identities=38% Similarity=0.804 Sum_probs=22.7
Q ss_pred ccccCCCCCCCcccccccccCCCCCCCCC
Q 000175 71 KLSVPPPLNLPSLRKEHERFDSSGSNGGP 99 (1926)
Q Consensus 71 klsvp~plnlpslrkeh~~~d~~~~~~~~ 99 (1926)
.-.||||-..||.++-..-||.-|+-||.
T Consensus 310 nE~~ppppempswqqqq~~~~~~ggrggg 338 (465)
T KOG3973|consen 310 NEMVPPPPEMPSWQQQQHTFDRQGGRGGG 338 (465)
T ss_pred ccCCCCCCCCCcHHHhcCCCCCCCCcCCC
Confidence 34589999999999998888887664443
No 105
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []. Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.
Probab=44.60 E-value=3.7e+02 Score=34.86 Aligned_cols=9 Identities=0% Similarity=0.290 Sum_probs=3.8
Q ss_pred ccccccccc
Q 000175 451 NNSVHSFNS 459 (1926)
Q Consensus 451 n~mmsSfs~ 459 (1926)
..++..+.+
T Consensus 242 e~al~KL~~ 250 (446)
T PF07227_consen 242 EEALAKLEN 250 (446)
T ss_pred HHHHHHHhC
Confidence 344444444
No 106
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway [].; GO: 0006914 autophagy; PDB: 3Q8T_A 3VP7_A 4DDP_A.
Probab=44.54 E-value=4.2e+02 Score=32.59 Aligned_cols=6 Identities=17% Similarity=0.939 Sum_probs=2.3
Q ss_pred Cchhhh
Q 000175 718 DWEDGE 723 (1926)
Q Consensus 718 DwEd~E 723 (1926)
+|.++.
T Consensus 167 ~W~EIN 172 (314)
T PF04111_consen 167 EWNEIN 172 (314)
T ss_dssp -HHHHH
T ss_pred ChHHHH
Confidence 455443
No 107
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]
Probab=42.65 E-value=4e+02 Score=33.03 Aligned_cols=12 Identities=17% Similarity=0.459 Sum_probs=5.6
Q ss_pred cCcccccccccc
Q 000175 470 YGSEQYNRFRGD 481 (1926)
Q Consensus 470 wGi~qynryrG~ 481 (1926)
|=++||+-|.+.
T Consensus 121 yidaQFEaYLQE 132 (406)
T KOG3859|consen 121 YIDAQFEAYLQE 132 (406)
T ss_pred HHHHHHHHHHHH
Confidence 444455544443
No 108
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=42.27 E-value=1.8e+02 Score=37.45 Aligned_cols=20 Identities=45% Similarity=0.689 Sum_probs=8.6
Q ss_pred CCCCCCCCCCCCCCCCCCce
Q 000175 36 HSGYYGSNRARPTGGGGGGM 55 (1926)
Q Consensus 36 ~~g~~~~~~~~~~~gg~ggm 55 (1926)
++|+.+...+.+|+++||||
T Consensus 71 ~s~~g~~s~~~gg~~~~~g~ 90 (641)
T KOG3915|consen 71 GSGGGGGSSGNGGGGGGGGG 90 (641)
T ss_pred CCCCCccccCCCCCCCCCCC
Confidence 33333333444444444444
No 109
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=42.10 E-value=1.3e+03 Score=33.72 Aligned_cols=10 Identities=30% Similarity=0.657 Sum_probs=4.5
Q ss_pred CCCCCCceee
Q 000175 1319 HPSQPPVFQF 1328 (1926)
Q Consensus 1319 h~s~~plfqf 1328 (1926)
|++.+=|++|
T Consensus 1210 ~~~~~~l~~~ 1219 (1317)
T KOG0612|consen 1210 HEFIPFLYHF 1219 (1317)
T ss_pred CcchHHHhhc
Confidence 4444444444
No 110
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=40.47 E-value=5.1e+02 Score=31.91 Aligned_cols=20 Identities=15% Similarity=0.298 Sum_probs=9.2
Q ss_pred CCCcccccccccc-cccCCcc
Q 000175 408 RPSSLNREANKET-KFMSSPF 427 (1926)
Q Consensus 408 rp~S~~R~~~K~s-kY~~sp~ 427 (1926)
.|.++.-.+.|+. +|++--.
T Consensus 59 ~~~qi~kah~kkv~kyHPDk~ 79 (379)
T COG5269 59 IPPQILKAHKKKVYKYHPDKT 79 (379)
T ss_pred CcHHHHHHHHHHHHHhCccch
Confidence 3334444444444 5555443
No 111
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=40.32 E-value=20 Score=44.10 Aligned_cols=20 Identities=45% Similarity=0.790 Sum_probs=9.1
Q ss_pred CCCCCCCCCCCCCCCCCCce
Q 000175 36 HSGYYGSNRARPTGGGGGGM 55 (1926)
Q Consensus 36 ~~g~~~~~~~~~~~gg~ggm 55 (1926)
+||+.|..+|.+||||+||+
T Consensus 441 gggr~gggrgrgggggrg~y 460 (465)
T KOG3973|consen 441 GGGRDGGGRGRGGGGGRGGY 460 (465)
T ss_pred CCCCCCCCCCCCCCCCCccc
Confidence 44444444444444555553
No 112
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=39.38 E-value=1e+03 Score=32.54 Aligned_cols=14 Identities=21% Similarity=0.074 Sum_probs=6.0
Q ss_pred CCCccchhHhhhcc
Q 000175 261 DTGSARRSEQVRKQ 274 (1926)
Q Consensus 261 ~~g~~~~~e~~rk~ 274 (1926)
.+|-.|.-=-.||+
T Consensus 210 SLGITCIELAERkP 223 (948)
T KOG0577|consen 210 SLGITCIELAERKP 223 (948)
T ss_pred eccchhhhhhhcCC
Confidence 34444533333444
No 113
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=39.35 E-value=1.3e+03 Score=33.57 Aligned_cols=17 Identities=12% Similarity=-0.142 Sum_probs=8.0
Q ss_pred CCCcccCCCCCcccccc
Q 000175 1348 SVPYVQPNVPANFSLNQ 1364 (1926)
Q Consensus 1348 ~~~~vq~~~~~~~~~nq 1364 (1926)
+++.|+++.+..-.+||
T Consensus 1202 ~~~~v~~~~~~~~~l~~ 1218 (1317)
T KOG0612|consen 1202 PNSLVHKGHEFIPFLYH 1218 (1317)
T ss_pred chhhcCCCCcchHHHhh
Confidence 44455555544444444
No 114
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=38.93 E-value=1.3e+03 Score=33.00 Aligned_cols=6 Identities=0% Similarity=-0.009 Sum_probs=2.3
Q ss_pred CCCCCC
Q 000175 501 PHNDPM 506 (1926)
Q Consensus 501 l~~DP~ 506 (1926)
+.+-.+
T Consensus 141 V~QG~V 146 (1163)
T COG1196 141 VSQGKV 146 (1163)
T ss_pred eecccH
Confidence 333333
No 115
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=37.96 E-value=7.3e+02 Score=32.46 Aligned_cols=11 Identities=18% Similarity=0.513 Sum_probs=8.1
Q ss_pred CCCCCcccccc
Q 000175 376 GREGNMWRASS 386 (1926)
Q Consensus 376 g~e~nsWr~ss 386 (1926)
|...|+|....
T Consensus 235 ~~~~~Lwicli 245 (493)
T KOG0804|consen 235 GCTEDLWICLI 245 (493)
T ss_pred cccccEEEEEE
Confidence 66778887765
No 116
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]
Probab=37.35 E-value=1.4e+03 Score=32.96 Aligned_cols=16 Identities=31% Similarity=0.468 Sum_probs=12.3
Q ss_pred CcccCCCccccccccc
Q 000175 404 GICERPSSLNREANKE 419 (1926)
Q Consensus 404 Gigvrp~S~~R~~~K~ 419 (1926)
|+|.|++-.+|+++.+
T Consensus 85 glG~rAs~tnRgsslK 100 (1074)
T KOG0250|consen 85 GLGGRASATNRGSSLK 100 (1074)
T ss_pred hhccccccccchhhHH
Confidence 6667888889988843
No 117
>PLN02316 synthase/transferase
Probab=36.55 E-value=1e+02 Score=43.12 Aligned_cols=24 Identities=13% Similarity=0.178 Sum_probs=14.9
Q ss_pred CCCCcccccccccccCCCCccccc
Q 000175 1057 SGNGNMIAPASSISAGDDEEWAVE 1080 (1926)
Q Consensus 1057 ~~~~~~~~~~s~~s~~dd~ew~~~ 1080 (1926)
..|+++..+..+-.++-=--|+-.
T Consensus 499 ~~~t~l~~~~ev~~~g~~NrWth~ 522 (1036)
T PLN02316 499 PANTVLNGKPEVWFRGSFNRWTHR 522 (1036)
T ss_pred CCCCcCCCCceEEEEccccCcCCC
Confidence 556666666666666665667655
No 118
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=36.54 E-value=1.8e+02 Score=37.58 Aligned_cols=8 Identities=50% Similarity=0.580 Sum_probs=3.7
Q ss_pred cceeeccC
Q 000175 177 KASVLRGE 184 (1926)
Q Consensus 177 ~~~vlrge 184 (1926)
|-|-|||-
T Consensus 178 KmVd~rG~ 185 (641)
T KOG3915|consen 178 KMVDLRGA 185 (641)
T ss_pred eeeeecCc
Confidence 44444544
No 119
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]
Probab=36.44 E-value=1.1e+03 Score=30.61 Aligned_cols=6 Identities=17% Similarity=0.263 Sum_probs=2.3
Q ss_pred CCCCCC
Q 000175 936 ECPSPS 941 (1926)
Q Consensus 936 ~~p~ps 941 (1926)
-+++|-
T Consensus 490 ~r~~~~ 495 (499)
T COG4372 490 PRHAPR 495 (499)
T ss_pred ccCCcc
Confidence 333333
No 120
>PF12004 DUF3498: Domain of unknown function (DUF3498); InterPro: IPR021887 This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 433 to 538 amino acids in length. This domain is found associated with PF00616 from PFAM, PF00168 from PFAM. This domain has two conserved sequence motifs: DLQ and PLSFQNP. ; PDB: 3BXJ_B.
Probab=35.15 E-value=13 Score=47.73 Aligned_cols=9 Identities=22% Similarity=0.730 Sum_probs=0.0
Q ss_pred HHHHHHHHH
Q 000175 571 FEAELERVQ 579 (1926)
Q Consensus 571 ~EaELEReq 579 (1926)
+|+|+..++
T Consensus 374 YEqEI~~Lk 382 (495)
T PF12004_consen 374 YEQEIQSLK 382 (495)
T ss_dssp ---------
T ss_pred HHHHHHHHH
Confidence 444444433
No 121
>PF06658 DUF1168: Protein of unknown function (DUF1168); InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=32.47 E-value=3.3e+02 Score=30.48 Aligned_cols=17 Identities=29% Similarity=0.479 Sum_probs=8.5
Q ss_pred ccccccCCCC-CCCCCCc
Q 000175 527 PFMKDFGSSS-FDGRDPF 543 (1926)
Q Consensus 527 pfmkDfgsS~-~DgrDP~ 543 (1926)
.|+.+..+|. +-|..-|
T Consensus 21 e~V~NV~GSSAGAGSGeF 38 (142)
T PF06658_consen 21 EFVRNVQGSSAGAGSGEF 38 (142)
T ss_pred eeeccccccccccCccHH
Confidence 3455544444 6666444
No 122
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=32.39 E-value=7.5e+02 Score=27.62 Aligned_cols=119 Identities=24% Similarity=0.175 Sum_probs=0.0
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000175 589 IIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAA 668 (1926)
Q Consensus 589 kEEEqERerEEeRREEEEReRkEREEEErQRReEEErRereErEErER~EaERReEEERKRrEEEERRreEEEERRKEEE 668 (1926)
..+.+.+-.+.....+..+...+...++.+++.++.+++...--+..+.+++...++.+.+.+++..++.+..+...+.+
T Consensus 35 l~~R~~~I~~~l~~A~~~~~ea~~~~~~~~~~l~~Ar~~a~~Ii~~A~~~a~~~~~e~~~~a~~e~~r~~~~a~~~I~~e 114 (161)
T COG0711 35 LDERQAKIADDLAEAERLKEEAQALLAEYEQELEEAREQASEIIEQAKKEAEQIAEEIKAEAEEELERIKEAAEAEIEAE 114 (161)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhhcchhhhhhhhhchhhc
Q 000175 669 KQKLLELEERIAKRQAEAAKSDSNSSDIADEKSSGLAKE 707 (1926)
Q Consensus 669 EeKRkEEEEe~KKeKaE~EKrekeAeakaEEKakqivkE 707 (1926)
+++..+.-........-..-..-............+.+.
T Consensus 115 ~~~a~~~l~~~~~~la~~~aekll~~~~~~~~~~~lid~ 153 (161)
T COG0711 115 KERALEELRAEVAELAVAIAEKLLGKKVDEAAQKDLIDA 153 (161)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHH
No 123
>KOG1425 consensus Microfibrillar-associated protein MFAP1 [Cytoskeleton]
Probab=29.63 E-value=5.1e+02 Score=32.89 Aligned_cols=8 Identities=38% Similarity=0.879 Sum_probs=4.9
Q ss_pred ccCCCCCC
Q 000175 276 EYFPGPLP 283 (1926)
Q Consensus 276 ~~~~gplp 283 (1926)
-|.+|--|
T Consensus 29 ryv~gk~p 36 (430)
T KOG1425|consen 29 RYVSGKAP 36 (430)
T ss_pred eecCCCCc
Confidence 37777644
No 124
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=29.12 E-value=1.5e+03 Score=32.30 Aligned_cols=15 Identities=20% Similarity=0.257 Sum_probs=11.1
Q ss_pred eccceeccccccCCC
Q 000175 1328 FGQLRYTSPVSQGVL 1342 (1926)
Q Consensus 1328 fgqlry~~pi~q~v~ 1342 (1926)
|-|.|.-+-|.||-+
T Consensus 1108 ~~qer~er~~Lkg~~ 1122 (1243)
T KOG0971|consen 1108 ISQERHERSILKGAQ 1122 (1243)
T ss_pred HHHHHHHHHHHhHHH
Confidence 567888877888754
No 125
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=28.95 E-value=1.1e+02 Score=38.75 Aligned_cols=9 Identities=44% Similarity=0.615 Sum_probs=3.7
Q ss_pred CCCCccccC
Q 000175 755 DNSSGFLDR 763 (1926)
Q Consensus 755 d~DSS~~dR 763 (1926)
..+|.|.++
T Consensus 414 g~dSg~~~d 422 (506)
T KOG2441|consen 414 GLDSGFADD 422 (506)
T ss_pred Ccccccccc
Confidence 334444444
No 126
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=27.08 E-value=3.1e+02 Score=35.07 Aligned_cols=7 Identities=43% Similarity=0.833 Sum_probs=3.2
Q ss_pred ccccccc
Q 000175 473 EQYNRFR 479 (1926)
Q Consensus 473 ~qynryr 479 (1926)
.||=+|.
T Consensus 172 s~YIryt 178 (506)
T KOG2441|consen 172 SQYIRYT 178 (506)
T ss_pred cceeeec
Confidence 3444444
No 127
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=26.28 E-value=3.1e+02 Score=35.96 Aligned_cols=14 Identities=43% Similarity=0.534 Sum_probs=6.8
Q ss_pred cCCCCCCccccccc
Q 000175 374 REGREGNMWRASSS 387 (1926)
Q Consensus 374 r~g~e~nsWr~ssp 387 (1926)
|.||+||+-.+.-|
T Consensus 350 R~gr~G~Aivfl~p 363 (567)
T KOG0345|consen 350 RAGREGNAIVFLNP 363 (567)
T ss_pred hccCccceEEEecc
Confidence 44555555544443
No 128
>PLN03188 kinesin-12 family protein; Provisional
Probab=26.21 E-value=2.3e+03 Score=31.54 Aligned_cols=13 Identities=38% Similarity=0.560 Sum_probs=6.6
Q ss_pred CCccccCCCCCCC
Q 000175 69 VPKLSVPPPLNLP 81 (1926)
Q Consensus 69 ~~klsvp~plnlp 81 (1926)
.+||-.|-|.+.|
T Consensus 64 ~~~~~sp~p~~pp 76 (1320)
T PLN03188 64 SAKLKSPLPPRPP 76 (1320)
T ss_pred cccccCCCCCCCC
Confidence 3455555555554
No 129
>PF00901 Orbi_VP5: Orbivirus outer capsid protein VP5; InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid. Cryoelectron microscopy indicates that VP5 is a trimer suggesting that there are 360 copies of VP5 per virion [].; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=25.39 E-value=1.7e+03 Score=29.59 Aligned_cols=34 Identities=32% Similarity=0.548 Sum_probs=14.3
Q ss_pred CCcchhhHHHHHhhhhhcccccccCchhHhHHHHH
Q 000175 541 DPFSAGLVGVVKKKKDVLKQTDFHDPVRESFEAEL 575 (1926)
Q Consensus 541 DP~s~~vlsliKKKKEe~Kqae~Ed~lREE~EaEL 575 (1926)
||.+..-... ..|-.++++..++++.+.+..+++
T Consensus 80 DPLsPgE~~l-~~Kl~eLE~e~k~d~v~~khn~~I 113 (508)
T PF00901_consen 80 DPLSPGEQGL-QRKLKELEDEQKEDEVREKHNKKI 113 (508)
T ss_pred CCCCHhHHHH-HHHHHHHHHHHhhHHHHHHHHHHH
Confidence 4444333333 333333343444445555544444
No 130
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=25.12 E-value=2e+03 Score=30.14 Aligned_cols=6 Identities=50% Similarity=0.855 Sum_probs=2.9
Q ss_pred CCCCCc
Q 000175 538 DGRDPF 543 (1926)
Q Consensus 538 DgrDP~ 543 (1926)
..+|.|
T Consensus 458 rnrdhF 463 (948)
T KOG0577|consen 458 RNRDHF 463 (948)
T ss_pred hhhhhh
Confidence 335555
No 131
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=25.02 E-value=1.7e+02 Score=42.04 Aligned_cols=13 Identities=15% Similarity=0.284 Sum_probs=7.0
Q ss_pred CCCCCcccccccc
Q 000175 376 GREGNMWRASSSL 388 (1926)
Q Consensus 376 g~e~nsWr~sspl 388 (1926)
+-+-.+|.++..-
T Consensus 1924 ~~~p~s~~a~~~~ 1936 (2220)
T KOG3598|consen 1924 AAAPTSWNAPIAN 1936 (2220)
T ss_pred hcCCccccccchh
Confidence 4455666665443
No 132
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]
Probab=24.83 E-value=1.3e+03 Score=30.09 Aligned_cols=142 Identities=18% Similarity=0.153 Sum_probs=0.0
Q ss_pred ccccCCCCCCCCCCc----chhhHHHHHhhhhhcccccccCchhHhHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
Q 000175 529 MKDFGSSSFDGRDPF----SAGLVGVVKKKKDVLKQTDFHDPVRESFEAELERVQKMQEQ-ERQRIIEEQERALELARRE 603 (1926)
Q Consensus 529 mkDfgsS~~DgrDP~----s~~vlsliKKKKEe~Kqae~Ed~lREE~EaELEReqReeEE-ERKRkEEEqERerEEeRRE 603 (1926)
+.|-.+++.+...|. ...++..+.++-+..+ ...+.+++=+++.++.... +......|.+...+++++.
T Consensus 122 ~f~i~~~qt~~d~PlC~eC~d~l~~~ld~e~~~~~------~e~~~Y~~~l~~Le~~~~~~~~~~~~~e~~~l~~eE~~L 195 (447)
T KOG2751|consen 122 LFDILSSQTQVDHPLCEECMDVLLNKLDKEVEDAE------DEVDTYKACLQRLEQQNQDVSEEDLLKELKNLKEEEERL 195 (447)
T ss_pred HHHHhhccCCcccchHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHhhcCcccchHHHHHHHHHHHHHHHHH
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000175 604 EEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAAKQKLLELE 676 (1926)
Q Consensus 604 EEEReRkEREEEErQRReEEErRereErEErER~EaERReEEERKRrEEEERRreEEEERRKEEEEeKRkEEE 676 (1926)
..+.++.++++++....+.+.+.++.+..+++..-...--.-.+..-+-+......+-++.-.+...+.....
T Consensus 196 ~q~lk~le~~~~~l~~~l~e~~~~~~~~~e~~~~~~~ey~~~~~q~~~~~del~Sle~q~~~s~~qldkL~kt 268 (447)
T KOG2751|consen 196 LQQLEELEKEEAELDHQLKELEFKAERLNEEEDQYWREYNNFQRQLIEHQDELDSLEAQIEYSQAQLDKLRKT 268 (447)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccchHHHHHHHHHHHHHHHHHHHhh
No 133
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=24.59 E-value=2.3e+03 Score=30.67 Aligned_cols=33 Identities=27% Similarity=0.435 Sum_probs=18.7
Q ss_pred cccCCCCCCcccccCCCCCCCCCCCCCCCCCcccccccc-CCcccc
Q 000175 308 DRDHGFSKSEAYWEGDFDMPRPSVLPHKPAHNVFERWGQ-RDSETG 352 (1926)
Q Consensus 308 ~r~~g~sk~e~~w~~~fd~~~~~~~p~k~~~~~~~~~gq-r~~~~~ 352 (1926)
|+..|--+.--|++- .+++.+|-|.-| |.-|.+
T Consensus 46 GKNnGsVqg~qYF~C------------d~ncG~FVr~sq~r~lEda 79 (1243)
T KOG0971|consen 46 GKNNGSVQGVQYFEC------------DENCGVFVRSSQVRELEDA 79 (1243)
T ss_pred CCCCCcccceeeEec------------CCCcceEeehhhhHHhhcc
Confidence 455565555566533 145667777766 555553
No 134
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]
Probab=24.50 E-value=1.5e+03 Score=29.70 Aligned_cols=8 Identities=38% Similarity=0.891 Sum_probs=3.3
Q ss_pred ccCCCCCC
Q 000175 397 DIGDNRNG 404 (1926)
Q Consensus 397 d~gner~G 404 (1926)
.+-|+-+|
T Consensus 76 qmDDD~nG 83 (575)
T KOG4403|consen 76 QMDDDHNG 83 (575)
T ss_pred hcccccCC
Confidence 34444444
No 135
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=23.54 E-value=60 Score=46.06 Aligned_cols=12 Identities=17% Similarity=0.332 Sum_probs=5.8
Q ss_pred ccccCCCCCcCCC
Q 000175 153 GVYVPPSVRSGTV 165 (1926)
Q Consensus 153 ~~~~~~s~~~~~~ 165 (1926)
..|+.| .++|++
T Consensus 1772 ~yyL~P-lPlPpe 1783 (2220)
T KOG3598|consen 1772 DYYLAP-LPLPPE 1783 (2220)
T ss_pred hhhccC-CCCCcc
Confidence 456555 444443
No 136
>KOG2505 consensus Ankyrin repeat protein [General function prediction only]
Probab=23.40 E-value=3.5e+02 Score=35.50 Aligned_cols=7 Identities=29% Similarity=0.472 Sum_probs=3.1
Q ss_pred cccCCCC
Q 000175 491 SSFSSGG 497 (1926)
Q Consensus 491 ~sfslG~ 497 (1926)
..||.|+
T Consensus 307 ~l~F~~~ 313 (591)
T KOG2505|consen 307 NLFFEGD 313 (591)
T ss_pred ceeecCC
Confidence 3444444
No 137
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=22.39 E-value=1.1e+03 Score=32.70 Aligned_cols=20 Identities=15% Similarity=0.197 Sum_probs=10.1
Q ss_pred hcccCCCCCCcccCCCCcee
Q 000175 1487 KSLTGSKAQGLTSGSRGKRY 1506 (1926)
Q Consensus 1487 k~~~~~k~~g~~sg~rg~~y 1506 (1926)
+-|-..++-++|.-|+-||+
T Consensus 817 Rq~Le~eF~nLi~~gtdrr~ 836 (916)
T KOG0249|consen 817 RQLLEREFNNLLALGTDRRL 836 (916)
T ss_pred HHHHHHHHHhhhcccccccC
Confidence 33444555555555554443
No 138
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]
Probab=21.93 E-value=2.6e+03 Score=30.45 Aligned_cols=31 Identities=26% Similarity=0.311 Sum_probs=17.0
Q ss_pred CCCCCCCCCCCCCCccccccc---cccccCCCCCCC
Q 000175 887 PPYPDRIYPNPETDVISSFGR---SRYSMRHPRVLP 919 (1926)
Q Consensus 887 PP~~eRmYqnse~d~~~~~~r---~rys~rqprvlp 919 (1926)
|+.-...|. .|++.+| |+. -+||+|++|..-
T Consensus 618 p~n~~~ayt-ldg~~~~-~~g~~~~~ySt~~~~~r~ 651 (1074)
T KOG0250|consen 618 PANVTKAYT-LDGRQIF-AGGPNYRVYSTRGTRARR 651 (1074)
T ss_pred Cccceeeec-cCccccc-cCCCCcceeccCCCCCCC
Confidence 333334454 4444442 333 489999987663
No 139
>COG4907 Predicted membrane protein [Function unknown]
Probab=21.58 E-value=64 Score=41.28 Aligned_cols=26 Identities=54% Similarity=0.966 Sum_probs=0.0
Q ss_pred CCCCCCCCCCCCCceEEeeccCcccccCCCccccCCCCCCCcccccccccCCCCCCCCCCCCCCCCC
Q 000175 41 GSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEHERFDSSGSNGGPAGGGVSGA 107 (1926)
Q Consensus 41 ~~~~~~~~~gg~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh~~~d~~~~~~~~~~~~~~g~ 107 (1926)
++.+++.+|||+||- ||..||||||+
T Consensus 569 ~S~~~~~~GGG~G~~-----------------------------------------gGg~GGGGGGa 594 (595)
T COG4907 569 SSRRSSSSGGGGGFS-----------------------------------------GGGSGGGGGGA 594 (595)
T ss_pred ccccCCCCCCCCCcC-----------------------------------------CCCCCCCCCCC
No 140
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics]
Probab=21.27 E-value=2.9e+02 Score=34.36 Aligned_cols=12 Identities=25% Similarity=0.207 Sum_probs=6.1
Q ss_pred CCCCCeeecCCC
Q 000175 279 PGPLPLVRLKPR 290 (1926)
Q Consensus 279 ~gplplvrl~~~ 290 (1926)
-|+-|+.+|+|-
T Consensus 25 ~g~~~~~h~~y~ 36 (410)
T KOG4715|consen 25 GGYNPYTHLAYS 36 (410)
T ss_pred CCCCcchhhhcc
Confidence 344455555543
No 141
>PF07415 Herpes_LMP2: Gammaherpesvirus latent membrane protein (LMP2) protein; InterPro: IPR010881 This family consists of several Gammaherpesvirus latent membrane protein (LMP2) proteins. Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) is a human gammaherpesvirus that infects and establishes latency in B lymphocytes in vivo. The latent membrane protein 2 (LMP2) gene is expressed in latently infected B cells and encodes two protein isoforms, LMP2A and LMP2B, that are identical except for an additional N-terminal 119 aa cytoplasmic domain which is present in the LMP2A isoform. LMP2A is thought to play a key role in either the establishment or the maintenance of latency and/or the reactivation of productive infection from the latent state. The significance of LMP2B and its role in pathogenesis remain unclear [].; GO: 0019042 latent virus infection, 0033644 host cell membrane; PDB: 2JO9_B 1UXW_C.
Probab=20.98 E-value=33 Score=42.33 Aligned_cols=42 Identities=33% Similarity=0.553 Sum_probs=0.0
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccC
Q 000175 92 SSGSNGGPAGGGVSGAGQRPGSSGTGWTKPGTAVGSDQKIND 133 (1926)
Q Consensus 92 ~~~~~~~~~~~~~~g~g~~p~~sg~gw~kp~~~~~~~~~~~~ 133 (1926)
.-+++|||-|+-|+++-.-|+..|.-|..|+.+..++.+.++
T Consensus 13 ~p~~~~~~dg~e~~~~~~~ps~~~~~~~~~~~p~~~d~~~~~ 54 (489)
T PF07415_consen 13 PPSPHGGPDGYEGSNNSQYPSSFGSSWNSPGPPNYEDYPSNS 54 (489)
T ss_dssp ------------------------------------------
T ss_pred CCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCcccCCCCC
Confidence 345677888899999999999999999999998888887764
Done!