Query         000243
Match_columns 1800
No_of_seqs    449 out of 1558
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 01:01:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/000243.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/000243hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0163 Myosin class VI heavy   98.9 1.2E-08 2.6E-13  124.7  12.7   29  838-866  1166-1194(1259)
  2 PF07001 BAT2_N:  BAT2 N-termin  98.6 1.9E-07 4.1E-12  102.0  10.7   69    8-102    16-84  (189)
  3 KOG1029 Endocytic adaptor prot  98.4 5.8E-06 1.3E-10  102.5  16.7   28  562-589   313-343 (1118)
  4 PTZ00121 MAEBL; Provisional     98.4 1.2E-05 2.5E-10  104.5  18.9   38  447-485   978-1015(2084)
  5 PTZ00121 MAEBL; Provisional     98.3 1.8E-05 3.9E-10  102.9  17.7   24  404-429   881-904 (2084)
  6 KOG1029 Endocytic adaptor prot  98.2 4.8E-05   1E-09   94.8  18.5   17   74-91     87-103 (1118)
  7 KOG4364 Chromatin assembly fac  98.1 0.00023 4.9E-09   88.2  21.8   44  809-854   492-537 (811)
  8 PTZ00266 NIMA-related protein   97.8 0.00023 4.9E-09   93.6  15.8   23  934-956   782-804 (1021)
  9 PRK09510 tolA cell envelope in  97.7  0.0017 3.7E-08   78.2  19.5   10  881-890   360-369 (387)
 10 PTZ00266 NIMA-related protein   97.6 0.00057 1.2E-08   90.0  15.4   15   52-66     25-39  (1021)
 11 KOG2891 Surface glycoprotein [  97.6  0.0027 5.8E-08   72.9  17.1   13  531-543   211-223 (445)
 12 KOG4364 Chromatin assembly fac  97.5  0.0022 4.7E-08   80.0  16.6   23 1271-1293  749-771 (811)
 13 COG3064 TolA Membrane protein   97.2  0.0097 2.1E-07   69.6  16.4   19  819-837   326-344 (387)
 14 KOG0163 Myosin class VI heavy   97.2  0.0066 1.4E-07   76.5  15.9   43  850-895  1214-1256(1259)
 15 PRK09510 tolA cell envelope in  97.1   0.029 6.2E-07   68.1  19.8   18  904-921   351-368 (387)
 16 KOG2072 Translation initiation  97.0   0.083 1.8E-06   68.0  22.8   15  761-775   896-910 (988)
 17 TIGR02794 tolA_full TolA prote  96.9   0.039 8.5E-07   66.1  18.9    6  885-890   324-329 (346)
 18 KOG4661 Hsp27-ERE-TATA-binding  96.9   0.039 8.4E-07   68.2  18.7   21  235-256   255-275 (940)
 19 PF05262 Borrelia_P83:  Borreli  96.9   0.024 5.2E-07   70.4  16.7   11  879-889   479-489 (489)
 20 COG3064 TolA Membrane protein   96.8   0.074 1.6E-06   62.6  18.9    7  824-830   323-329 (387)
 21 KOG2891 Surface glycoprotein [  96.6    0.11 2.4E-06   60.3  18.5    8  388-395   157-164 (445)
 22 KOG4661 Hsp27-ERE-TATA-binding  96.4   0.026 5.7E-07   69.6  12.1   18  322-339   355-372 (940)
 23 KOG1144 Translation initiation  96.2   0.031 6.8E-07   71.3  11.7   11 1355-1365  939-949 (1064)
 24 KOG1144 Translation initiation  96.0   0.028   6E-07   71.7   9.8    6 1132-1137  730-735 (1064)
 25 KOG2412 Nuclear-export-signal   95.3     0.6 1.3E-05   58.6  17.6   36  806-841   420-455 (591)
 26 KOG4817 Unnamed protein [Funct  95.1    0.45 9.8E-06   57.3  15.3   65    8-96     15-79  (468)
 27 KOG2412 Nuclear-export-signal   95.1    0.75 1.6E-05   57.8  17.6   15  817-831   409-423 (591)
 28 KOG2072 Translation initiation  95.0     2.8   6E-05   55.0  22.6    8  770-777   923-930 (988)
 29 KOG0742 AAA+-type ATPase [Post  95.0     1.2 2.7E-05   54.9  18.6   12  721-732   252-263 (630)
 30 KOG2002 TPR-containing nuclear  94.2    0.23 4.9E-06   65.4  10.8   11  549-559   758-768 (1018)
 31 PF09726 Macoilin:  Transmembra  94.1    0.84 1.8E-05   59.5  15.6    9  188-196   196-204 (697)
 32 PF13904 DUF4207:  Domain of un  93.7       2 4.3E-05   50.1  16.2    9  547-555    89-97  (264)
 33 KOG0742 AAA+-type ATPase [Post  92.2     4.5 9.7E-05   50.3  16.6    7  537-543    70-76  (630)
 34 PRK00106 hypothetical protein;  92.0     8.1 0.00018   49.5  19.3    8  725-732   204-211 (535)
 35 PF09726 Macoilin:  Transmembra  91.8     3.5 7.5E-05   54.1  16.3    7  547-553   423-429 (697)
 36 PF12037 DUF3523:  Domain of un  91.5      15 0.00032   43.8  19.3    9  508-516    26-34  (276)
 37 KOG3654 Uncharacterized CH dom  87.7       3 6.6E-05   52.1  10.4   17   75-91     17-33  (708)
 38 PRK00409 recombination and DNA  86.8      15 0.00034   48.9  16.9   12  277-288   222-233 (782)
 39 PF07946 DUF1682:  Protein of u  86.6     2.5 5.5E-05   50.4   8.9    7  339-345    67-73  (321)
 40 PRK12705 hypothetical protein;  84.4      63  0.0014   41.7  19.7   12  548-559    22-33  (508)
 41 COG4942 Membrane-bound metallo  84.2      45 0.00097   42.0  17.8   10  785-794   356-365 (420)
 42 PF02029 Caldesmon:  Caldesmon;  84.0       4 8.7E-05   51.6   9.3   10  876-885   460-469 (492)
 43 PF12128 DUF3584:  Protein of u  82.1      44 0.00095   46.7  18.6   21 1220-1240 1159-1179(1201)
 44 TIGR01069 mutS2 MutS2 family p  81.5      44 0.00095   44.8  17.6   13  277-289   217-229 (771)
 45 PF09731 Mitofilin:  Mitochondr  80.8   1E+02  0.0022   39.6  20.0   15  319-333    27-41  (582)
 46 PLN03086 PRLI-interacting fact  80.3     9.9 0.00021   49.0  10.8    9 1006-1014  325-333 (567)
 47 PRK11637 AmiB activator; Provi  79.6      76  0.0016   39.4  17.8    7  850-856   386-392 (428)
 48 KOG0579 Ste20-like serine/thre  78.6      33 0.00071   45.1  14.2   13  182-194   472-484 (1187)
 49 KOG1103 Predicted coiled-coil   78.2      18 0.00038   44.1  11.3   54  958-1025  449-502 (561)
 50 PLN02316 synthase/transferase   77.6      41 0.00088   46.5  15.7   11  379-389   140-150 (1036)
 51 KOG0980 Actin-binding protein   77.6 2.5E+02  0.0054   38.6  21.7    9  525-533   311-319 (980)
 52 KOG2689 Predicted ubiquitin re  76.2      23  0.0005   42.3  11.3   15  798-812   249-263 (290)
 53 KOG3654 Uncharacterized CH dom  74.9      21 0.00045   45.3  10.9   14  205-218   119-132 (708)
 54 PLN02316 synthase/transferase   73.0      56  0.0012   45.3  15.2    9  267-275   120-128 (1036)
 55 KOG1103 Predicted coiled-coil   72.7 1.9E+02   0.004   36.0  17.6   14 1217-1230  510-523 (561)
 56 PTZ00491 major vault protein;   72.5 1.1E+02  0.0023   41.7  17.0   11  150-160   198-208 (850)
 57 PRK13428 F0F1 ATP synthase sub  72.1 1.9E+02  0.0041   36.7  18.5   25  825-849   242-266 (445)
 58 KOG1265 Phospholipase C [Lipid  71.6      90   0.002   42.5  15.8   15  318-333   752-767 (1189)
 59 KOG4722 Zn-finger protein [Gen  71.5 1.3E+02  0.0028   38.0  16.2   14  189-202    82-95  (672)
 60 KOG0579 Ste20-like serine/thre  71.0 1.3E+02  0.0027   40.2  16.5   11  710-720   965-975 (1187)
 61 PF06098 Radial_spoke_3:  Radia  69.8      43 0.00094   40.4  11.8   12  336-347     3-14  (291)
 62 PF06637 PV-1:  PV-1 protein (P  69.5 1.6E+02  0.0035   37.0  16.3   12  721-732   417-428 (442)
 63 KOG0994 Extracellular matrix g  69.2 1.3E+02  0.0028   42.0  16.6   64  162-232  1193-1261(1758)
 64 KOG2507 Ubiquitin regulatory p  68.7      12 0.00026   46.7   7.1   12  907-918   464-475 (506)
 65 KOG0994 Extracellular matrix g  68.5   1E+02  0.0022   42.9  15.5   11  547-557  1516-1526(1758)
 66 KOG0161 Myosin class II heavy   67.8 1.9E+02  0.0041   42.9  18.8    9  185-193   302-310 (1930)
 67 KOG2689 Predicted ubiquitin re  65.4      57  0.0012   39.2  11.4   13  809-821   249-261 (290)
 68 KOG1265 Phospholipase C [Lipid  65.2 1.7E+02  0.0038   40.0  16.4   11  421-431   824-834 (1189)
 69 KOG0161 Myosin class II heavy   64.9 2.4E+02  0.0051   41.9  18.9   11  253-263   454-464 (1930)
 70 KOG0921 Dosage compensation co  63.2      13 0.00027   50.1   6.2   25   36-60   1204-1232(1282)
 71 KOG0288 WD40 repeat protein Ti  62.4 3.1E+02  0.0068   35.0  17.0   19  994-1012  380-398 (459)
 72 KOG1363 Predicted regulator of  61.3      50  0.0011   42.1  10.6   10  291-300    63-72  (460)
 73 KOG1363 Predicted regulator of  61.0      34 0.00074   43.4   9.2    8  503-510   216-223 (460)
 74 KOG2507 Ubiquitin regulatory p  60.8      12 0.00026   46.7   5.1    8  785-792   345-352 (506)
 75 PRK04863 mukB cell division pr  60.0 3.8E+02  0.0082   39.1  19.6   17 1200-1216 1033-1049(1486)
 76 PF10168 Nup88:  Nuclear pore c  59.1 1.3E+02  0.0027   40.5  14.1   15   81-95     83-97  (717)
 77 KOG4722 Zn-finger protein [Gen  59.0 4.3E+02  0.0094   33.7  17.3    7  551-557   281-287 (672)
 78 PF15359 CDV3:  Carnitine defic  53.6      33 0.00072   37.0   6.4   63  116-193    59-123 (129)
 79 PTZ00491 major vault protein;   52.5   3E+02  0.0066   37.8  15.8    8  347-354   389-396 (850)
 80 PF04094 DUF390:  Protein of un  51.2 6.4E+02   0.014   34.4  17.8   29  723-753   671-699 (828)
 81 KOG0976 Rho/Rac1-interacting s  50.9   6E+02   0.013   35.0  17.4   13 1534-1546 1197-1209(1265)
 82 KOG0982 Centrosomal protein Nu  50.9 6.7E+02   0.014   32.4  18.6    9  549-557   225-233 (502)
 83 KOG0933 Structural maintenance  49.9 8.1E+02   0.017   34.7  18.8   21  537-557   662-682 (1174)
 84 KOG0681 Actin-related protein   48.7 1.1E+02  0.0023   40.0  10.6   16  469-484   199-214 (645)
 85 TIGR02680 conserved hypothetic  48.3 5.6E+02   0.012   37.0  18.4   11 1496-1506 1246-1256(1353)
 86 KOG2441 mRNA splicing factor/p  48.0      34 0.00074   42.5   6.1    7  448-454   190-196 (506)
 87 COG2433 Uncharacterized conser  46.8 5.5E+02   0.012   34.4  16.2   12  539-550   343-354 (652)
 88 KOG3973 Uncharacterized conser  46.4      33 0.00072   42.0   5.6   29   71-99    310-338 (465)
 89 PRK04863 mukB cell division pr  46.2 9.8E+02   0.021   35.3  20.1   10  867-876   759-768 (1486)
 90 KOG0681 Actin-related protein   46.0 1.7E+02  0.0036   38.4  11.6    6  469-474   149-154 (645)
 91 KOG3859 Septins (P-loop GTPase  44.7 3.8E+02  0.0081   33.1  13.5   11  421-431   120-130 (406)
 92 PF05667 DUF812:  Protein of un  44.1 7.1E+02   0.015   33.2  17.1   10  187-196    47-56  (594)
 93 PF06936 Selenoprotein_S:  Sele  43.3 1.4E+02  0.0031   34.2   9.7    6  524-529    17-22  (190)
 94 PRK12472 hypothetical protein;  42.8 4.1E+02  0.0089   34.6  14.2   10  469-478   122-131 (508)
 95 TIGR02169 SMC_prok_A chromosom  41.8 1.1E+03   0.024   32.5  19.1    9  779-787   573-581 (1164)
 96 COG4499 Predicted membrane pro  41.5      73  0.0016   39.9   7.5   20  545-564   344-363 (434)
 97 PLN03188 kinesin-12 family pro  39.9 1.1E+03   0.024   34.3  18.3   12   70-81     65-76  (1320)
 98 KOG3756 Pinin (desmosome-assoc  39.5 8.6E+02   0.019   30.4  17.6   14  376-389    53-66  (340)
 99 PRK12472 hypothetical protein;  39.1 6.5E+02   0.014   33.0  15.0    7  909-915   481-487 (508)
100 KOG0996 Structural maintenance  38.3 7.2E+02   0.016   35.6  16.1   11  853-863   666-676 (1293)
101 KOG3973 Uncharacterized conser  36.2      25 0.00054   43.0   2.6   19   36-54    441-459 (465)
102 KOG3915 Transcription regulato  35.0   3E+02  0.0064   35.5  11.1   20   36-55     71-90  (641)
103 KOG3915 Transcription regulato  34.7 2.7E+02  0.0059   35.8  10.8    8  177-184   178-185 (641)
104 KOG0996 Structural maintenance  34.1 1.5E+03   0.033   32.7  18.1    6  786-791   608-613 (1293)
105 PRK02292 V-type ATP synthase s  34.0   7E+02   0.015   27.8  13.1   85  565-649     8-92  (188)
106 KOG2668 Flotillins [Intracellu  33.2   1E+03   0.022   30.2  14.9   13  488-500   130-142 (428)
107 KOG0612 Rho-associated, coiled  28.4 2.1E+03   0.045   31.6  18.0   12  721-732   760-771 (1317)
108 KOG0976 Rho/Rac1-interacting s  28.3 1.8E+03    0.04   30.9  17.3   22 1270-1296  972-993 (1265)
109 COG5269 ZUO1 Ribosome-associat  27.3   8E+02   0.017   30.1  12.4   12  721-732   338-349 (379)
110 KOG2894 Uncharacterized conser  27.1 3.6E+02  0.0077   33.0   9.6  125  544-668    11-186 (331)
111 KOG0345 ATP-dependent RNA heli  27.1 2.6E+02  0.0057   36.3   9.0   10  376-385   352-361 (567)
112 COG5269 ZUO1 Ribosome-associat  26.9 5.9E+02   0.013   31.2  11.3    7  274-280    19-25  (379)
113 KOG0249 LAR-interacting protei  26.8 1.4E+03   0.031   31.4  15.5   13  912-924   440-452 (916)
114 KOG4572 Predicted DNA-binding   26.5 1.4E+03    0.03   31.8  15.3   15   69-84    229-243 (1424)
115 KOG0612 Rho-associated, coiled  26.3 1.8E+03   0.039   32.2  16.9   26  423-448   308-333 (1317)
116 PF06658 DUF1168:  Protein of u  26.1 5.1E+02   0.011   28.9  10.0   15  529-543    23-38  (142)
117 KOG2129 Uncharacterized conser  24.9 1.6E+03   0.035   29.1  18.5   13  475-487    40-52  (552)
118 KOG2505 Ankyrin repeat protein  23.6 3.4E+02  0.0073   35.5   9.1    9  347-355   254-262 (591)
119 KOG2441 mRNA splicing factor/p  23.1 3.9E+02  0.0084   34.0   9.2    9  471-479   170-178 (506)
120 PF08317 Spc7:  Spc7 kinetochor  21.4 1.5E+03   0.033   27.6  16.0  157  527-691   104-265 (325)
121 COG1579 Zn-ribbon protein, pos  21.2 1.5E+03   0.032   27.3  16.7  142  568-709    25-166 (239)
122 KOG2751 Beclin-like protein [S  21.1 1.9E+03   0.041   28.6  14.6   13  531-543   124-136 (447)
123 PF07415 Herpes_LMP2:  Gammaher  20.6      34 0.00074   42.0   0.1   42   92-133    13-54  (489)
124 KOG0288 WD40 repeat protein Ti  20.5   2E+03   0.042   28.4  17.7   13  772-784   187-199 (459)
125 TIGR01144 ATP_synt_b ATP synth  20.3 1.1E+03   0.023   25.2  16.1   96  589-684    24-119 (147)
126 PRK09173 F0F1 ATP synthase sub  20.3 1.1E+03   0.025   25.6  16.0   96  589-684    31-126 (159)

No 1  
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=98.87  E-value=1.2e-08  Score=124.67  Aligned_cols=29  Identities=21%  Similarity=0.327  Sum_probs=25.3

Q ss_pred             cccCCcccccCCCCccccccccccccccc
Q 000243          838 VSRGQRWNMSGDGDHYGRNIEMESDFHEN  866 (1800)
Q Consensus       838 ~~r~qRWnAp~DGd~~gRq~eIdSdq~EN  866 (1800)
                      -.+...|.+||||.||.||+++|++.+.-
T Consensus      1166 ~~k~gmWyaHFdGq~I~RQm~l~~~kpP~ 1194 (1259)
T KOG0163|consen 1166 NTKRGMWYAHFDGQWIARQMELHPDKPPI 1194 (1259)
T ss_pred             CCccceEEEecCcHHHHhhheecCCCCCe
Confidence            46788999999999999999999887654


No 2  
>PF07001 BAT2_N:  BAT2 N-terminus;  InterPro: IPR009738 This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2. BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [].
Probab=98.60  E-value=1.9e-07  Score=102.01  Aligned_cols=69  Identities=35%  Similarity=0.485  Sum_probs=47.9

Q ss_pred             cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeecCCccccccCCccccCCCCCCCcccccc
Q 000243            8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH   87 (1800)
Q Consensus         8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh   87 (1800)
                      .||.++|||..|--.+.--+                  -....-..||.+|++=      +.. =-||||.||||||.||
T Consensus        16 ~Ky~~l~in~~YkGks~e~q------------------k~~~~~~hGmqsLGKv------~~a-RRmPpPaNLPSLKaEn   70 (189)
T PF07001_consen   16 PKYSSLNINSLYKGKSLEPQ------------------KSTVPRRHGMQSLGKV------PSA-RRMPPPANLPSLKAEN   70 (189)
T ss_pred             ccceeechhhhhcCCccccc------------------cCCccCCCcceecccc------ccc-ccCCCCCCCcchhhhc
Confidence            38999999999933332210                  1122237799999982      111 1289999999999999


Q ss_pred             cccCCCCCCCCCCCC
Q 000243           88 ERFDSSGSNGGPAGG  102 (1800)
Q Consensus        88 ~~~d~~~~~~~~~~~  102 (1800)
                      .++|++-.. +|.+|
T Consensus        71 ~GnDpnv~l-VP~~G   84 (189)
T PF07001_consen   71 KGNDPNVSL-VPKGG   84 (189)
T ss_pred             cCCCCCcee-ecCCC
Confidence            999977776 66543


No 3  
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.38  E-value=5.8e-06  Score=102.50  Aligned_cols=28  Identities=43%  Similarity=0.662  Sum_probs=14.1

Q ss_pred             cccCchhhHHH---HHHHHHHHHHHHHHHHH
Q 000243          562 DFHDPVRESFE---AELERVQKMQEQERQRI  589 (1800)
Q Consensus       562 E~edqeREElE---aELErkrreeEEERrRk  589 (1800)
                      .|+++.++.++   +|++++++..+++.+|+
T Consensus       313 TFEDKrkeNy~kGqaELerRRq~leeqqqre  343 (1118)
T KOG1029|consen  313 TFEDKRKENYEKGQAELERRRQALEEQQQRE  343 (1118)
T ss_pred             chhhhhHHhHhhhhHHHHHHHHHHHHHHHHH
Confidence            34455454444   46666655555444433


No 4  
>PTZ00121 MAEBL; Provisional
Probab=98.35  E-value=1.2e-05  Score=104.49  Aligned_cols=38  Identities=13%  Similarity=-0.149  Sum_probs=16.9

Q ss_pred             CCCCcccccccccccccCCCCcccCcccccccccccccc
Q 000243          447 RQPWNNSVHSFNSQRAERNPWEQYGSEQYNRFRGDAFQR  485 (1800)
Q Consensus       447 gQpwn~~msS~s~R~~Ert~p~~ygi~qynr~rgdsfQn  485 (1800)
                      +.-|.|++.--++=-.-.+.| --=|+--|+|--.+++-
T Consensus       978 ~~N~~N~~~~~GkCyi~~~KP-TCvI~k~N~fsfTALss 1015 (2084)
T PTZ00121        978 PVNDNNIEIANGECYHILQKP-TCVIDKENHFSFTALTA 1015 (2084)
T ss_pred             CccchhhhhhcCeeEEEecCc-cceecCcchhhhhhccc
Confidence            444555555555444444555 22233334344444443


No 5  
>PTZ00121 MAEBL; Provisional
Probab=98.27  E-value=1.8e-05  Score=102.88  Aligned_cols=24  Identities=21%  Similarity=0.207  Sum_probs=12.9

Q ss_pred             CcccCCCccccccccccccccCcccc
Q 000243          404 GICERPSSLNREANKETKFMSSPFRD  429 (1800)
Q Consensus       404 Gig~Rp~S~~R~a~ke~kYv~s~~r~  429 (1800)
                      ..|.+|  .+-.+.++=-|++|-.|.
T Consensus       881 p~Cf~p--~Kt~~~KnwtYvSSfiRP  904 (2084)
T PTZ00121        881 PNCQII--RKTLDSKDWTYVSSFIRP  904 (2084)
T ss_pred             Cccccc--ccccccccceeeccccCC
Confidence            445555  444455555666665554


No 6  
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.19  E-value=4.8e-05  Score=94.77  Aligned_cols=17  Identities=47%  Similarity=0.677  Sum_probs=9.8

Q ss_pred             cCCCCCCCcccccccccC
Q 000243           74 VPPPLNLPSLRKEHERFD   91 (1800)
Q Consensus        74 vp~plnlpslrkeh~~~d   91 (1800)
                      ||+-|- |||-|---+|-
T Consensus        87 lP~~LP-Psll~~~~~~~  103 (1118)
T KOG1029|consen   87 LPPVLP-PSLLKQPPRNA  103 (1118)
T ss_pred             CCCCCC-hHHhccCCcCC
Confidence            444433 66777766665


No 7  
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=98.11  E-value=0.00023  Score=88.23  Aligned_cols=44  Identities=14%  Similarity=0.277  Sum_probs=31.3

Q ss_pred             cccCCCCCCcccccccccCCCCc--chhhhccccCCcccccCCCCccc
Q 000243          809 KEFYGGPGIMSSRNYYKAGILEP--HMDEFTVSRGQRWNMSGDGDHYG  854 (1800)
Q Consensus       809 lefyggaGFvKKrPY~kGgtTD~--~~DDYr~~r~qRWnAp~DGd~~g  854 (1800)
                      -.|||.+.  ||...++++.+-.  .+.||.++.+.-|-..--|.-+.
T Consensus       492 P~YyGTWr--KKS~~VsarrPlAq~~llDYEVdSDeEWEEEepGESlS  537 (811)
T KOG4364|consen  492 PGYYGTWR--KKSQVVSARRPLAQDPLLDYEVDSDEEWEEEEPGESLS  537 (811)
T ss_pred             Cccccccc--ccccccccCCcccccccccccccCcccccccCCCcccc
Confidence            45777766  5555566665544  67799999999998877776443


No 8  
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.82  E-value=0.00023  Score=93.57  Aligned_cols=23  Identities=30%  Similarity=0.141  Sum_probs=12.8

Q ss_pred             CCCCCCCCccccccccccccccc
Q 000243          934 ENECPSPSTFQENEVEYNRLLRS  956 (1800)
Q Consensus       934 ~~~~~~~s~f~~~~~~~~~~~r~  956 (1800)
                      ++--|+-++=+--|..|+|..|.
T Consensus       782 ~~~~~~~~~~~~~~~~~~~~~~~  804 (1021)
T PTZ00266        782 EAVNPICSAEAHYERVYNHGNRG  804 (1021)
T ss_pred             hhccchhccCCchhccccCCccc
Confidence            44445555545556666666555


No 9  
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.71  E-value=0.0017  Score=78.15  Aligned_cols=10  Identities=20%  Similarity=0.225  Sum_probs=5.1

Q ss_pred             CCCCCCCCCC
Q 000243          881 YRGNVHPPYP  890 (1800)
Q Consensus       881 S~~rPfPP~p  890 (1800)
                      -+..+||++|
T Consensus       360 ar~a~lP~pP  369 (387)
T PRK09510        360 AKTAKIPKPP  369 (387)
T ss_pred             HHcCCCCCCC
Confidence            3445555554


No 10 
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.65  E-value=0.00057  Score=90.00  Aligned_cols=15  Identities=20%  Similarity=0.286  Sum_probs=9.1

Q ss_pred             CCceEEeecCCcccc
Q 000243           52 GGGMLVLSRPRSSQK   66 (1800)
Q Consensus        52 ~ggm~vlsr~r~~~~   66 (1800)
                      +=|.|.|.+.+.+..
T Consensus        25 gFGtVYLAkdk~tg~   39 (1021)
T PTZ00266         25 RFGEVFLVKHKRTQE   39 (1021)
T ss_pred             CCeEEEEEEECCCCe
Confidence            445677777665543


No 11 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=97.55  E-value=0.0027  Score=72.90  Aligned_cols=13  Identities=31%  Similarity=0.439  Sum_probs=11.6

Q ss_pred             cCCCCCCCCCCcc
Q 000243          531 DFGSSSFDGRDPF  543 (1800)
Q Consensus       531 DFgSSsfDgrdpF  543 (1800)
                      .|.+++|+++.+|
T Consensus       211 q~~gfg~g~dlff  223 (445)
T KOG2891|consen  211 QFHGFGFGGDLFF  223 (445)
T ss_pred             eeeccccCcchhH
Confidence            5889999999988


No 12 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=97.50  E-value=0.0022  Score=80.00  Aligned_cols=23  Identities=26%  Similarity=0.176  Sum_probs=16.4

Q ss_pred             CCCccceEEeeecccCCCCCCCC
Q 000243         1271 SQAETPVKLQFGLFSGPSLIPSP 1293 (1800)
Q Consensus      1271 ~~~e~pv~lqfglfsgpslipsp 1293 (1800)
                      -+.-+||+-|+-.-.||+--|-|
T Consensus       749 q~~~lqv~~qw~y~l~~~~sp~~  771 (811)
T KOG4364|consen  749 QDSRLQVKKQWLYKLGLSPSPDK  771 (811)
T ss_pred             ccccccccceeeeeecCCCCCCC
Confidence            45778888888888777654443


No 13 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=97.20  E-value=0.0097  Score=69.64  Aligned_cols=19  Identities=0%  Similarity=-0.150  Sum_probs=7.7

Q ss_pred             ccccccccCCCCcchhhhc
Q 000243          819 SSRNYYKAGILEPHMDEFT  837 (1800)
Q Consensus       819 KKrPY~kGgtTD~~~DDYr  837 (1800)
                      |.|-...--++|.++.+|.
T Consensus       326 K~C~l~ikL~pdGtl~~~~  344 (387)
T COG3064         326 KTCRLRIKLAPDGTLLDIK  344 (387)
T ss_pred             ceeEEEEEEcCCcceeecc
Confidence            3343333333444444444


No 14 
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=97.19  E-value=0.0066  Score=76.51  Aligned_cols=43  Identities=23%  Similarity=0.237  Sum_probs=31.1

Q ss_pred             CCccccccccccccccccccccCCcccccCCCCCCCCCCCCCccCC
Q 000243          850 GDHYGRNIEMESDFHENITERYGDVGWGQGRYRGNVHPPYPDRIYP  895 (1800)
Q Consensus       850 Gd~~gRq~eIdSdq~ENigerfGd~gW~~~sS~~rPfPP~peRmyq  895 (1800)
                      |..-.|..+|.+..++..|+|+|+..+.+ .  +-.-|.+|..|.|
T Consensus      1214 gL~rKrGAEI~~~eFe~~W~r~Ggk~~~~-~--~~a~p~~~~a~~q 1256 (1259)
T KOG0163|consen 1214 GLTRKRGAEILEHEFEREWERNGGKAYKN-L--GAAKPNGPAAAMQ 1256 (1259)
T ss_pred             ccccccccccChHHHHHHHHHhCcHHhHh-h--cccCCCchHHHHh
Confidence            44567889999999999999999988877 2  2244455555544


No 15 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=97.11  E-value=0.029  Score=68.06  Aligned_cols=18  Identities=11%  Similarity=0.348  Sum_probs=7.3

Q ss_pred             cccccccccCCCCCCCCC
Q 000243          904 SFGRSRYSMRHPRVLPPP  921 (1800)
Q Consensus       904 ~~~r~ry~~rqprvlppp  921 (1800)
                      .|-|.=.....-.+||+|
T Consensus       351 aldrAA~~Aar~a~lP~p  368 (387)
T PRK09510        351 ALCQAALAAAKTAKIPKP  368 (387)
T ss_pred             HHHHHHHHHHHcCCCCCC
Confidence            344433333333444544


No 16 
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=96.99  E-value=0.083  Score=68.02  Aligned_cols=15  Identities=33%  Similarity=0.406  Sum_probs=11.3

Q ss_pred             ccCCCCCCCCCcccc
Q 000243          761 LDRGKPFNSWRRDAF  775 (1800)
Q Consensus       761 ldR~Kp~nSWrRd~~  775 (1800)
                      ..|..+.+.|||...
T Consensus       896 s~~a~~~~~WrR~a~  910 (988)
T KOG2072|consen  896 SPRAPEEAEWRRGAG  910 (988)
T ss_pred             CCCCCcchHHhhccC
Confidence            356678899999873


No 17 
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=96.95  E-value=0.039  Score=66.08  Aligned_cols=6  Identities=33%  Similarity=0.340  Sum_probs=2.8

Q ss_pred             CCCCCC
Q 000243          885 VHPPYP  890 (1800)
Q Consensus       885 PfPP~p  890 (1800)
                      |||++|
T Consensus       324 p~P~Pp  329 (346)
T TIGR02794       324 KLPMPP  329 (346)
T ss_pred             CCCCCC
Confidence            555443


No 18 
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.93  E-value=0.039  Score=68.25  Aligned_cols=21  Identities=10%  Similarity=-0.023  Sum_probs=13.8

Q ss_pred             CCCcccccCCCcccCCccccCC
Q 000243          235 DGMSPRLQSGQDVVGSRLRENG  256 (1800)
Q Consensus       235 ~~m~pq~~~~~~~~g~~~~~~~  256 (1800)
                      --..|-+.+-+.+.|.+ ++++
T Consensus       255 aeeedlfdSahpeegDl-Dlas  275 (940)
T KOG4661|consen  255 AEEEDLFDSAHPEEGDL-DLAS  275 (940)
T ss_pred             hhccccccccCCccccc-cccc
Confidence            34566677778888876 5544


No 19 
>PF05262 Borrelia_P83:  Borrelia P83/100 protein;  InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=96.87  E-value=0.024  Score=70.39  Aligned_cols=11  Identities=0%  Similarity=-0.073  Sum_probs=5.4

Q ss_pred             CCCCCCCCCCC
Q 000243          879 GRYRGNVHPPY  889 (1800)
Q Consensus       879 ~sS~~rPfPP~  889 (1800)
                      |.-...||.||
T Consensus       479 S~~eV~P~T~~  489 (489)
T PF05262_consen  479 SEVEVLPFTSF  489 (489)
T ss_pred             CccccCCCCCC
Confidence            44444555543


No 20 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=96.81  E-value=0.074  Score=62.65  Aligned_cols=7  Identities=0%  Similarity=0.116  Sum_probs=3.0

Q ss_pred             cccCCCC
Q 000243          824 YKAGILE  830 (1800)
Q Consensus       824 ~kGgtTD  830 (1800)
                      |.|.+|.
T Consensus       323 f~gK~C~  329 (387)
T COG3064         323 FAGKTCR  329 (387)
T ss_pred             cCCceeE
Confidence            3444444


No 21 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=96.64  E-value=0.11  Score=60.33  Aligned_cols=8  Identities=13%  Similarity=0.110  Sum_probs=4.0

Q ss_pred             cccCCccc
Q 000243          388 LQKDGFGA  395 (1800)
Q Consensus       388 l~k~w~~a  395 (1800)
                      |+-.||.-
T Consensus       157 ip~kwf~l  164 (445)
T KOG2891|consen  157 IPCKWFAL  164 (445)
T ss_pred             Ccceeeee
Confidence            44456643


No 22 
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]
Probab=96.37  E-value=0.026  Score=69.65  Aligned_cols=18  Identities=22%  Similarity=0.442  Sum_probs=11.5

Q ss_pred             CCCCCCCCCCCCCCCCCc
Q 000243          322 GDFDMPRPSVLPHKPAHN  339 (1800)
Q Consensus       322 ~~fd~~~~~~~p~k~~~~  339 (1800)
                      +-|||---.-||+-|.-+
T Consensus       355 rKfdfdAcnevpPapkeS  372 (940)
T KOG4661|consen  355 RKFDFDACNEVPPAPKES  372 (940)
T ss_pred             ccccccccccCCCCCccc
Confidence            357777666677665544


No 23 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.17  E-value=0.031  Score=71.26  Aligned_cols=11  Identities=18%  Similarity=0.323  Sum_probs=5.6

Q ss_pred             CCCCccccccC
Q 000243         1355 NVPANFSLNQN 1365 (1800)
Q Consensus      1355 ~~~~~~~~nqn 1365 (1800)
                      .+.+||-||.-
T Consensus       939 ~ilpn~ifN~R  949 (1064)
T KOG1144|consen  939 QILPNCIFNKR  949 (1064)
T ss_pred             hhhhHhhccCC
Confidence            34455666643


No 24 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=95.95  E-value=0.028  Score=71.72  Aligned_cols=6  Identities=17%  Similarity=0.401  Sum_probs=3.0

Q ss_pred             cceeee
Q 000243         1132 SNLVLG 1137 (1800)
Q Consensus      1132 ~~~vlg 1137 (1800)
                      |-+|||
T Consensus       730 D~Ivvc  735 (1064)
T KOG1144|consen  730 DQIVVC  735 (1064)
T ss_pred             CEEEEc
Confidence            455554


No 25 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=95.33  E-value=0.6  Score=58.61  Aligned_cols=36  Identities=8%  Similarity=-0.017  Sum_probs=30.9

Q ss_pred             CCccccCCCCCCcccccccccCCCCcchhhhccccC
Q 000243          806 VPRKEFYGGPGIMSSRNYYKAGILEPHMDEFTVSRG  841 (1800)
Q Consensus       806 fprlefyggaGFvKKrPY~kGgtTD~~~DDYr~~r~  841 (1800)
                      ||++--...+.+.|+|||..+..++...++|.++-+
T Consensus       420 ~Pdv~dlllA~l~KkCP~~VPf~~~~~~Eq~~k~mG  455 (591)
T KOG2412|consen  420 FPDVGDLLLARLHKKCPYVVPFHIVNSTEQYQKMMG  455 (591)
T ss_pred             CchHHHHHHHHHHhcCCccccccccCcHHHHHHhhc
Confidence            777777778889999999999999999999986543


No 26 
>KOG4817 consensus Unnamed protein [Function unknown]
Probab=95.15  E-value=0.45  Score=57.27  Aligned_cols=65  Identities=32%  Similarity=0.436  Sum_probs=42.4

Q ss_pred             cceEEeecccccCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCceEEeecCCccccccCCccccCCCCCCCcccccc
Q 000243            8 NKFVSVNLNKSYGQSYHQHQNNHHHNLSHSGYYGSNRARPTGGGGGGMLVLSRPRSSQKAAVPKLSVPPPLNLPSLRKEH   87 (1800)
Q Consensus         8 ~k~~svnln~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~ggm~vlsr~r~~~~~~~~klsvp~plnlpslrkeh   87 (1800)
                      .||--|-||..|--.-.-           .+-      ..-..-+-||-.|.+      | ..---.|||-||||||-|-
T Consensus        15 ~K~talsin~~ykg~~~~-----------~aq------R~~vp~RhGmQslGK------a-~v~rrmpPPAnLPSLkaEn   70 (468)
T KOG4817|consen   15 PKFTALSINRMYKGSREP-----------SAQ------RNQVPRRHGMQSLGK------A-KVPRRMPPPANLPSLKAEN   70 (468)
T ss_pred             cCcceeehhhhhcCCcCC-----------ccc------ccCCCccchhhhhcc------c-cccccCCCCCCCcchhhcc
Confidence            589888888888433100           000      122233678877764      1 2223579999999999999


Q ss_pred             cccCCCCCC
Q 000243           88 ERFDSSGSN   96 (1800)
Q Consensus        88 ~~~d~~~~~   96 (1800)
                      -+.|++-..
T Consensus        71 ~g~dpn~~l   79 (468)
T KOG4817|consen   71 HGSDPNNLL   79 (468)
T ss_pred             cCCCCCcee
Confidence            999987543


No 27 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=95.12  E-value=0.75  Score=57.79  Aligned_cols=15  Identities=7%  Similarity=-0.017  Sum_probs=9.4

Q ss_pred             CcccccccccCCCCc
Q 000243          817 IMSSRNYYKAGILEP  831 (1800)
Q Consensus       817 FvKKrPY~kGgtTD~  831 (1800)
                      |.+.+-|.--.++|-
T Consensus       409 la~V~l~i~~q~Pdv  423 (591)
T KOG2412|consen  409 LAKVILYIWSQFPDV  423 (591)
T ss_pred             HHHHHHHHHHhCchH
Confidence            347777776666654


No 28 
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]
Probab=95.04  E-value=2.8  Score=55.04  Aligned_cols=8  Identities=25%  Similarity=0.630  Sum_probs=4.2

Q ss_pred             CCcccccC
Q 000243          770 WRRDAFES  777 (1800)
Q Consensus       770 WrRd~~lr  777 (1800)
                      .+||.+.|
T Consensus       923 ~~r~~~~R  930 (988)
T KOG2072|consen  923 FSRDDVDR  930 (988)
T ss_pred             cccccccc
Confidence            34555555


No 29 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=95.01  E-value=1.2  Score=54.86  Aligned_cols=12  Identities=33%  Similarity=0.565  Sum_probs=7.7

Q ss_pred             hhHHHHhhhccC
Q 000243          721 DGERMVERITTS  732 (1800)
Q Consensus       721 D~eRmvERI~TS  732 (1800)
                      .-+.+++.|+|.
T Consensus       252 eRekwl~aInTt  263 (630)
T KOG0742|consen  252 EREKWLEAINTT  263 (630)
T ss_pred             HHHHHHHHHhhh
Confidence            345677777776


No 30 
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]
Probab=94.23  E-value=0.23  Score=65.37  Aligned_cols=11  Identities=27%  Similarity=0.217  Sum_probs=4.5

Q ss_pred             HHHHhhhhhhh
Q 000243          549 GVVKKKKDVLK  559 (1800)
Q Consensus       549 a~mKKKKEelK  559 (1800)
                      ..+++-.+...
T Consensus       758 ~v~kkla~s~l  768 (1018)
T KOG2002|consen  758 LVLKKLAESIL  768 (1018)
T ss_pred             HHHHHHHHHHH
Confidence            33444444333


No 31 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=94.11  E-value=0.84  Score=59.51  Aligned_cols=9  Identities=56%  Similarity=0.693  Sum_probs=4.6

Q ss_pred             cccccccCC
Q 000243          188 SLQAALPAA  196 (1800)
Q Consensus       188 sl~a~~p~~  196 (1800)
                      .|+-|||+.
T Consensus       196 ~l~~~lp~~  204 (697)
T PF09726_consen  196 LLQQALPPE  204 (697)
T ss_pred             HHHHhCCCc
Confidence            455555544


No 32 
>PF13904 DUF4207:  Domain of unknown function (DUF4207)
Probab=93.70  E-value=2  Score=50.11  Aligned_cols=9  Identities=11%  Similarity=0.025  Sum_probs=4.0

Q ss_pred             HHHHHHhhh
Q 000243          547 LVGVVKKKK  555 (1800)
Q Consensus       547 lla~mKKKK  555 (1800)
                      ...|+..|.
T Consensus        89 ye~Wl~~K~   97 (264)
T PF13904_consen   89 YEEWLSAKE   97 (264)
T ss_pred             HHHHHHHHH
Confidence            344444444


No 33 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=92.25  E-value=4.5  Score=50.28  Aligned_cols=7  Identities=43%  Similarity=0.757  Sum_probs=3.6

Q ss_pred             CCCCCcc
Q 000243          537 FDGRDPF  543 (1800)
Q Consensus       537 fDgrdpF  543 (1800)
                      ..++||-
T Consensus        70 ~~gFDpe   76 (630)
T KOG0742|consen   70 WSGFDPE   76 (630)
T ss_pred             ccCCChH
Confidence            4455554


No 34 
>PRK00106 hypothetical protein; Provisional
Probab=92.03  E-value=8.1  Score=49.50  Aligned_cols=8  Identities=13%  Similarity=0.318  Sum_probs=3.0

Q ss_pred             HHhhhccC
Q 000243          725 MVERITTS  732 (1800)
Q Consensus       725 mvERI~TS  732 (1800)
                      ...+|...
T Consensus       204 ~a~~ii~~  211 (535)
T PRK00106        204 MAKDLLAQ  211 (535)
T ss_pred             HHHHHHHH
Confidence            33333333


No 35 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=91.82  E-value=3.5  Score=54.10  Aligned_cols=7  Identities=57%  Similarity=0.453  Sum_probs=2.9

Q ss_pred             HHHHHHh
Q 000243          547 LVGVVKK  553 (1800)
Q Consensus       547 lla~mKK  553 (1800)
                      +.+.+|+
T Consensus       423 LE~dvkk  429 (697)
T PF09726_consen  423 LEADVKK  429 (697)
T ss_pred             HHHHHHH
Confidence            3344444


No 36 
>PF12037 DUF3523:  Domain of unknown function (DUF3523);  InterPro: IPR021911  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with PF00004 from PFAM. This domain has a conserved LER sequence motif. 
Probab=91.51  E-value=15  Score=43.82  Aligned_cols=9  Identities=22%  Similarity=0.110  Sum_probs=4.0

Q ss_pred             CcccCcCcc
Q 000243          508 NFSRDKRPL  516 (1800)
Q Consensus       508 ~F~rDkRpl  516 (1800)
                      +.++||..+
T Consensus        26 ~~~FDP~aL   34 (276)
T PF12037_consen   26 ASGFDPEAL   34 (276)
T ss_pred             cCCCCcHHH
Confidence            444444444


No 37 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=87.67  E-value=3  Score=52.14  Aligned_cols=17  Identities=24%  Similarity=0.235  Sum_probs=10.4

Q ss_pred             CCCCCCCcccccccccC
Q 000243           75 PPPLNLPSLRKEHERFD   91 (1800)
Q Consensus        75 p~plnlpslrkeh~~~d   91 (1800)
                      +.||---+-.++|+--|
T Consensus        17 s~~l~ed~~~~~~ed~d   33 (708)
T KOG3654|consen   17 SKPLSEDPTKAPVEDPD   33 (708)
T ss_pred             CcccccccccCCcCCCc
Confidence            45555555566777666


No 38 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=86.83  E-value=15  Score=48.90  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=5.9

Q ss_pred             cCCCCCCeeecC
Q 000243          277 YFPGPLPLVRLK  288 (1800)
Q Consensus       277 ~~~gplplvrl~  288 (1800)
                      +|.-|..+|-||
T Consensus       222 ~y~ep~~~~~ln  233 (782)
T PRK00409        222 LYIEPQSVVELN  233 (782)
T ss_pred             EEEEcHHHHHHH
Confidence            444455555554


No 39 
>PF07946 DUF1682:  Protein of unknown function (DUF1682);  InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6 from SWISSPROT) is described as being an adipocyte-specific protein, but no evidence of this was found. 
Probab=86.64  E-value=2.5  Score=50.39  Aligned_cols=7  Identities=29%  Similarity=0.486  Sum_probs=2.7

Q ss_pred             ccccccc
Q 000243          339 NVFERWG  345 (1800)
Q Consensus       339 ~~~~~~~  345 (1800)
                      +.|.-+.
T Consensus        67 ~~f~~ya   73 (321)
T PF07946_consen   67 NEFTFYA   73 (321)
T ss_pred             ceEEEEE
Confidence            3344343


No 40 
>PRK12705 hypothetical protein; Provisional
Probab=84.38  E-value=63  Score=41.66  Aligned_cols=12  Identities=33%  Similarity=0.495  Sum_probs=5.8

Q ss_pred             HHHHHhhhhhhh
Q 000243          548 VGVVKKKKDVLK  559 (1800)
Q Consensus       548 la~mKKKKEelK  559 (1800)
                      +.+++++....+
T Consensus        22 ~~~~~~~~~~~~   33 (508)
T PRK12705         22 VVLLKKRQRLAK   33 (508)
T ss_pred             HHHHHHHHHHHH
Confidence            345555554433


No 41 
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=84.23  E-value=45  Score=42.03  Aligned_cols=10  Identities=30%  Similarity=0.192  Sum_probs=6.5

Q ss_pred             ccccccCCCC
Q 000243          785 TQDAENGHYS  794 (1800)
Q Consensus       785 pqd~eNG~~s  794 (1800)
                      -=||.+||++
T Consensus       356 IldhG~gy~s  365 (420)
T COG4942         356 ILDHGGGYHS  365 (420)
T ss_pred             EEEcCCccEE
Confidence            3577777764


No 42 
>PF02029 Caldesmon:  Caldesmon;  InterPro: IPR006018  This group of proteins includes two protein families: caldesmon and lymphocyte specific protein.  Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart). 
Probab=84.04  E-value=4  Score=51.62  Aligned_cols=10  Identities=20%  Similarity=0.388  Sum_probs=5.8

Q ss_pred             cccCCCCCCC
Q 000243          876 WGQGRYRGNV  885 (1800)
Q Consensus       876 W~~~sS~~rP  885 (1800)
                      |+...+.++.
T Consensus       460 w~~~~~e~~~  469 (492)
T PF02029_consen  460 WLTKTPEGSK  469 (492)
T ss_pred             hhcCCCCCCC
Confidence            6666555554


No 43 
>PF12128 DUF3584:  Protein of unknown function (DUF3584);  InterPro: IPR021979  This family consist of uncharacterised bacterial proteins. 
Probab=82.12  E-value=44  Score=46.74  Aligned_cols=21  Identities=24%  Similarity=0.381  Sum_probs=11.9

Q ss_pred             cchhhhhhhhcccccCccccc
Q 000243         1220 TQLSAASELMDHLNANSCSVV 1240 (1800)
Q Consensus      1220 ~~~~~~~~~~~~~~a~~~s~~ 1240 (1800)
                      .+..-.-.+++-|+..-|+..
T Consensus      1159 L~~~Nv~~l~~~~~~nnI~li 1179 (1201)
T PF12128_consen 1159 LHPNNVKKLLDMCNSNNISLI 1179 (1201)
T ss_pred             CChHHHHHHHHHHHhCCceEE
Confidence            445555556666666555444


No 44 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=81.50  E-value=44  Score=44.83  Aligned_cols=13  Identities=23%  Similarity=0.664  Sum_probs=7.2

Q ss_pred             cCCCCCCeeecCC
Q 000243          277 YFPGPLPLVRLKP  289 (1800)
Q Consensus       277 ~~~gplplvrl~~  289 (1800)
                      +|.-|..+|-||-
T Consensus       217 ~~~ep~~~~~ln~  229 (771)
T TIGR01069       217 FYIEPQAIVKLNN  229 (771)
T ss_pred             EEEEcHHHHHHHH
Confidence            5555655665553


No 45 
>PF09731 Mitofilin:  Mitochondrial inner membrane protein;  InterPro: IPR019133  Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=80.82  E-value=1e+02  Score=39.58  Aligned_cols=15  Identities=13%  Similarity=0.071  Sum_probs=6.0

Q ss_pred             cccCCCCCCCCCCCC
Q 000243          319 YWEGDFDMPRPSVLP  333 (1800)
Q Consensus       319 ~w~~~fd~~~~~~~p  333 (1800)
                      ||+..|+-.-...+|
T Consensus        27 ~~n~~f~d~f~~~vP   41 (582)
T PF09731_consen   27 KQNDNFRDFFEEYVP   41 (582)
T ss_pred             hcChHHHHHHHHhCC
Confidence            444444333333344


No 46 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=80.30  E-value=9.9  Score=49.02  Aligned_cols=9  Identities=44%  Similarity=0.357  Sum_probs=4.1

Q ss_pred             eeecCCCCC
Q 000243         1006 LSVSSAPDS 1014 (1800)
Q Consensus      1006 lsvsspp~s 1014 (1800)
                      |=||-+|-.
T Consensus       325 lfvS~~~~~  333 (567)
T PLN03086        325 LYVSKHPLV  333 (567)
T ss_pred             EEEcccccc
Confidence            444444443


No 47 
>PRK11637 AmiB activator; Provisional
Probab=79.63  E-value=76  Score=39.40  Aligned_cols=7  Identities=14%  Similarity=0.249  Sum_probs=2.6

Q ss_pred             CCccccc
Q 000243          850 GDHYGRN  856 (1800)
Q Consensus       850 Gd~~gRq  856 (1800)
                      |+++.++
T Consensus       386 G~~V~~G  392 (428)
T PRK11637        386 GAQVRAG  392 (428)
T ss_pred             cCEECCC
Confidence            3333333


No 48 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=78.63  E-value=33  Score=45.07  Aligned_cols=13  Identities=31%  Similarity=0.399  Sum_probs=8.0

Q ss_pred             cCCCCcccccccc
Q 000243          182 RGEDFPSLQAALP  194 (1800)
Q Consensus       182 rgedfpsl~a~~p  194 (1800)
                      -|+-|-++|++.+
T Consensus       472 ~G~~~~s~qs~~s  484 (1187)
T KOG0579|consen  472 QGSTFFSPQSSAS  484 (1187)
T ss_pred             cCccccCccccCC
Confidence            4666667766653


No 49 
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=78.24  E-value=18  Score=44.10  Aligned_cols=54  Identities=24%  Similarity=0.157  Sum_probs=28.3

Q ss_pred             cccccccccccccccCCCcccccCCCCchhhhhccccccccccCCCcceeecCCCCCCCCCCCccccc
Q 000243          958 SISLAGLDRSEQHNLAQPEIIDVQPESTENEEQNLERSTTSRCDSQSSLSVSSAPDSPVHLSHDDLDV 1025 (1800)
Q Consensus       958 ~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~e~~~~~r~~~~~~~sqsslsvsspp~sp~h~shdd~d~ 1025 (1800)
                      +..-++|.++||-...|--       ++  -.|++-  ++.-.|-|+|.--| ||+-  .||-|=.|-
T Consensus       449 saSSp~~qssyqvginqrf-------ha--aRhkf~--aqad~dqqasgl~s-p~s~--dLSP~L~d~  502 (561)
T KOG1103|consen  449 SASSPAVQSSYQVGINQRF-------HA--ARHKFA--AQADMDQQASGLNS-PASM--DLSPDLEDL  502 (561)
T ss_pred             ccCChhhhhhhhhcchhhh-------hh--ccchhh--hcccCcccccccCC-CccC--CCCccHHHH
Confidence            3445678888876333221       12  234555  46777888776543 3332  245554443


No 50 
>PLN02316 synthase/transferase
Probab=77.64  E-value=41  Score=46.52  Aligned_cols=11  Identities=18%  Similarity=0.129  Sum_probs=4.7

Q ss_pred             CCceeeccccc
Q 000243          379 GNMWRASSSLQ  389 (1800)
Q Consensus       379 ~~~Wr~~sPl~  389 (1800)
                      +|.|++-+...
T Consensus       140 ~~~~f~~P~~~  150 (1036)
T PLN02316        140 GNKLFVYPQVV  150 (1036)
T ss_pred             CCeEEeccccc
Confidence            34444444333


No 51 
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]
Probab=77.61  E-value=2.5e+02  Score=38.60  Aligned_cols=9  Identities=22%  Similarity=0.091  Sum_probs=3.6

Q ss_pred             CCcccccCC
Q 000243          525 DDPFMKDFG  533 (1800)
Q Consensus       525 EDp~MqDFg  533 (1800)
                      +|++..++.
T Consensus       311 ~~~~~~~~~  319 (980)
T KOG0980|consen  311 LDLFEAEPA  319 (980)
T ss_pred             ccccccCcc
Confidence            344444443


No 52 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=76.17  E-value=23  Score=42.29  Aligned_cols=15  Identities=27%  Similarity=0.213  Sum_probs=8.5

Q ss_pred             CCCCCCCCCCccccC
Q 000243          798 DSAFGGRAVPRKEFY  812 (1800)
Q Consensus       798 Ds~~g~R~fprlefy  812 (1800)
                      |++-=+++|||..|.
T Consensus       249 ~P~~f~t~fPR~tf~  263 (290)
T KOG2689|consen  249 DPYSFHTGFPRVTFT  263 (290)
T ss_pred             CCeeeecCCCceecc
Confidence            455556666666443


No 53 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=74.88  E-value=21  Score=45.32  Aligned_cols=14  Identities=21%  Similarity=0.389  Sum_probs=6.6

Q ss_pred             ccchhHhhhchhhh
Q 000243          205 DGFSQKQKQGMSQE  218 (1800)
Q Consensus       205 ~~~~qk~k~~~~~~  218 (1800)
                      +.|.-||+|.|+.-
T Consensus       119 ea~fakqrqklgks  132 (708)
T KOG3654|consen  119 EAIFAKQRQKLGKS  132 (708)
T ss_pred             HHHHHHHHHHhchh
Confidence            33444555555443


No 54 
>PLN02316 synthase/transferase
Probab=73.00  E-value=56  Score=45.29  Aligned_cols=9  Identities=44%  Similarity=0.715  Sum_probs=4.3

Q ss_pred             hhHhhhccc
Q 000243          267 RSEQVRKQE  275 (1800)
Q Consensus       267 ~~e~~rk~~  275 (1800)
                      +.|+.||+.
T Consensus       120 ~~~~~~~~~  128 (1036)
T PLN02316        120 ERENLRKRE  128 (1036)
T ss_pred             hHHHHHHHH
Confidence            344555544


No 55 
>KOG1103 consensus Predicted coiled-coil protein [Function unknown]
Probab=72.73  E-value=1.9e+02  Score=35.98  Aligned_cols=14  Identities=14%  Similarity=-0.021  Sum_probs=7.5

Q ss_pred             ccccchhhhhhhhc
Q 000243         1217 QDNTQLSAASELMD 1230 (1800)
Q Consensus      1217 ~~~~~~~~~~~~~~ 1230 (1800)
                      ++||.+..+.+-.-
T Consensus       510 ~~gps~~q~l~Rf~  523 (561)
T KOG1103|consen  510 NAGPSSNQALERFL  523 (561)
T ss_pred             hcCCchhHHHHHHH
Confidence            45666555555443


No 56 
>PTZ00491 major vault protein; Provisional
Probab=72.48  E-value=1.1e+02  Score=41.70  Aligned_cols=11  Identities=27%  Similarity=0.552  Sum_probs=6.1

Q ss_pred             CCcccccCCCC
Q 000243          150 DGVGVYVPPSV  160 (1800)
Q Consensus       150 ~~~~~~~~~s~  160 (1800)
                      ++.|.|+|..-
T Consensus       198 t~~gaylP~v~  208 (850)
T PTZ00491        198 RTPGAYLPGVF  208 (850)
T ss_pred             eccccccCCCc
Confidence            44666666543


No 57 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=72.13  E-value=1.9e+02  Score=36.70  Aligned_cols=25  Identities=20%  Similarity=0.510  Sum_probs=16.2

Q ss_pred             ccCCCCcchhhhccccCCcccccCC
Q 000243          825 KAGILEPHMDEFTVSRGQRWNMSGD  849 (1800)
Q Consensus       825 kGgtTD~~~DDYr~~r~qRWnAp~D  849 (1800)
                      .|....+.++=-.....+||..+.|
T Consensus       242 ~~~~~~~~~~~~~~~~~~rws~~~d  266 (445)
T PRK13428        242 SGKVGAPTLEVLRTAVSQRWSANSD  266 (445)
T ss_pred             CcCCCHHHHHHHHHHHhCccCcccc
Confidence            3444445555455678899988866


No 58 
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=71.56  E-value=90  Score=42.47  Aligned_cols=15  Identities=40%  Similarity=0.724  Sum_probs=7.3

Q ss_pred             ccccCC-CCCCCCCCCC
Q 000243          318 AYWEGD-FDMPRPSVLP  333 (1800)
Q Consensus       318 ~~w~~~-fd~~~~~~~p  333 (1800)
                      +-|+++ |.| +--|||
T Consensus       752 pvy~eepfvF-~KVvLp  767 (1189)
T KOG1265|consen  752 PVYEEEPFVF-RKVVLP  767 (1189)
T ss_pred             cccccCCccc-ceeccc
Confidence            345544 444 344666


No 59 
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=71.46  E-value=1.3e+02  Score=37.96  Aligned_cols=14  Identities=43%  Similarity=0.496  Sum_probs=6.0

Q ss_pred             ccccccCCCCchhh
Q 000243          189 LQAALPAASGSEKK  202 (1800)
Q Consensus       189 l~a~~p~~~~~~~k  202 (1800)
                      |||..|+--+++.|
T Consensus        82 lqagtpplqVnEEk   95 (672)
T KOG4722|consen   82 LQAGTPPLQVNEEK   95 (672)
T ss_pred             HhcCCCCCCCchhh
Confidence            34444444444433


No 60 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=70.96  E-value=1.3e+02  Score=40.19  Aligned_cols=11  Identities=27%  Similarity=0.619  Sum_probs=5.3

Q ss_pred             CCccccCCCCc
Q 000243          710 LPKMADVGDWE  720 (1800)
Q Consensus       710 l~K~kd~dDwE  720 (1800)
                      +.+.++..-|+
T Consensus       965 LlRarEaaiWE  975 (1187)
T KOG0579|consen  965 LLRAREAAIWE  975 (1187)
T ss_pred             HHHHHHHHHhH
Confidence            44444444455


No 61 
>PF06098 Radial_spoke_3:  Radial spoke protein 3;  InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=69.80  E-value=43  Score=40.36  Aligned_cols=12  Identities=17%  Similarity=0.230  Sum_probs=5.3

Q ss_pred             CCCccccccccC
Q 000243          336 PAHNVFERWGQR  347 (1800)
Q Consensus       336 ~~~~~~~~~~qr  347 (1800)
                      |++-.||+|=-|
T Consensus         3 ~~NiM~D~RV~R   14 (291)
T PF06098_consen    3 YGNIMYDRRVVR   14 (291)
T ss_pred             cccccCCCCcCC
Confidence            344445544333


No 62 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=69.50  E-value=1.6e+02  Score=37.02  Aligned_cols=12  Identities=33%  Similarity=0.277  Sum_probs=4.6

Q ss_pred             hhHHHHhhhccC
Q 000243          721 DGERMVERITTS  732 (1800)
Q Consensus       721 D~eRmvERI~TS  732 (1800)
                      .++.-..+|..|
T Consensus       417 ~leefkrriles  428 (442)
T PF06637_consen  417 SLEEFKRRILES  428 (442)
T ss_pred             HHHHHHHHHHhc
Confidence            333333344333


No 63 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=69.24  E-value=1.3e+02  Score=42.03  Aligned_cols=64  Identities=25%  Similarity=0.294  Sum_probs=36.1

Q ss_pred             cCCCCCCccCCCcccccccccCCCCccccccccCCCCchh--hhcccch---hHhhhchhhhccccccCCCCCCCc
Q 000243          162 SGTVGPALSSFAPAEKASVLRGEDFPSLQAALPAASGSEK--KQKDGFS---QKQKQGMSQELGNNEQKDGCRFNA  232 (1800)
Q Consensus       162 ~~~~~~~~~~~~~~e~~~vlrgedfpsl~a~~p~~~~~~~--k~~~~~~---qk~k~~~~~~~~~~e~~~~~~~~~  232 (1800)
                      +|.++|-...|..+|+-+       --+|+.|-+++++..  ++-...-   .||-|.+-+.|..-|.+-.+-.++
T Consensus      1193 tGv~gay~s~f~~me~kl-------~~ir~il~~~svs~~~i~~l~~~~~~lr~~l~~~~e~L~~~E~~Lsdi~~~ 1261 (1758)
T KOG0994|consen 1193 TGVLGAYASRFLDMEEKL-------EEIRAILSAPSVSAEDIAQLASATESLRRQLQALTEDLPQEEETLSDITNS 1261 (1758)
T ss_pred             ccCchhhHhHHHHHHHHH-------HHHHHHhcCCCccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhc
Confidence            566666555555554332       124566656666655  2322222   377788888888666665554433


No 64 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=68.72  E-value=12  Score=46.65  Aligned_cols=12  Identities=42%  Similarity=0.570  Sum_probs=5.8

Q ss_pred             ccccccCCCCCC
Q 000243          907 RSRYSMRHPRVL  918 (1800)
Q Consensus       907 r~ry~~rqprvl  918 (1800)
                      |+|--|+.|--.
T Consensus       464 rsr~~~~Rp~~~  475 (506)
T KOG2507|consen  464 RSRRRMPRPAEV  475 (506)
T ss_pred             hhhhcCcCCccc
Confidence            555555444333


No 65 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=68.49  E-value=1e+02  Score=42.93  Aligned_cols=11  Identities=18%  Similarity=0.431  Sum_probs=4.5

Q ss_pred             HHHHHHhhhhh
Q 000243          547 LVGVVKKKKDV  557 (1800)
Q Consensus       547 lla~mKKKKEe  557 (1800)
                      +...|++....
T Consensus      1516 L~~~I~e~v~s 1526 (1758)
T KOG0994|consen 1516 LTGEIQERVAS 1526 (1758)
T ss_pred             HHHHHHHHHHh
Confidence            33444443333


No 66 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=67.83  E-value=1.9e+02  Score=42.88  Aligned_cols=9  Identities=22%  Similarity=0.298  Sum_probs=4.7

Q ss_pred             CCccccccc
Q 000243          185 DFPSLQAAL  193 (1800)
Q Consensus       185 dfpsl~a~~  193 (1800)
                      ||.-|....
T Consensus       302 ~Y~f~~~~~  310 (1930)
T KOG0161|consen  302 DYKFLSNGE  310 (1930)
T ss_pred             hhhhhcccc
Confidence            555555544


No 67 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=65.43  E-value=57  Score=39.18  Aligned_cols=13  Identities=8%  Similarity=0.015  Sum_probs=6.6

Q ss_pred             cccCCCCCCcccc
Q 000243          809 KEFYGGPGIMSSR  821 (1800)
Q Consensus       809 lefyggaGFvKKr  821 (1800)
                      .+|....||+++.
T Consensus       249 ~P~~f~t~fPR~t  261 (290)
T KOG2689|consen  249 DPYSFHTGFPRVT  261 (290)
T ss_pred             CCeeeecCCCcee
Confidence            3455555555544


No 68 
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]
Probab=65.17  E-value=1.7e+02  Score=40.05  Aligned_cols=11  Identities=18%  Similarity=0.486  Sum_probs=5.9

Q ss_pred             ccccCcccccc
Q 000243          421 KFMSSPFRDTV  431 (1800)
Q Consensus       421 kYv~s~~r~~v  431 (1800)
                      -||+--|.+.+
T Consensus       824 dyvpd~~~d~~  834 (1189)
T KOG1265|consen  824 DYVPDDLSDLV  834 (1189)
T ss_pred             ccCCchhhhHH
Confidence            45555555544


No 69 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=64.85  E-value=2.4e+02  Score=41.94  Aligned_cols=11  Identities=9%  Similarity=-0.197  Sum_probs=6.1

Q ss_pred             ccCCCCCCCCC
Q 000243          253 RENGGINHDTG  263 (1800)
Q Consensus       253 ~~~~~~~~~~g  263 (1800)
                      +-++-..|.+.
T Consensus       454 DiaGFEIfe~n  464 (1930)
T KOG0161|consen  454 DIAGFEIFEFN  464 (1930)
T ss_pred             eeccccccCcC
Confidence            55555555554


No 70 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=63.15  E-value=13  Score=50.05  Aligned_cols=25  Identities=44%  Similarity=0.570  Sum_probs=12.0

Q ss_pred             CCCCCCCC----CCCCCCCCCCceEEeec
Q 000243           36 HSGYYGSN----RARPTGGGGGGMLVLSR   60 (1800)
Q Consensus        36 ~~g~~~~~----~~~~~~~~~ggm~vlsr   60 (1800)
                      ++|+||.+    ++++|.|.|||.-=.||
T Consensus      1204 gsGGYGgsa~~~~~~~Gagvg~GyrGvsr 1232 (1282)
T KOG0921|consen 1204 GSGGYGGSAPSARANYGAGVGNGYRGVSR 1232 (1282)
T ss_pred             CCCCCCCCCCCCCCCccccccCCCccccC
Confidence            44555443    24445555666633333


No 71 
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=62.45  E-value=3.1e+02  Score=34.98  Aligned_cols=19  Identities=21%  Similarity=0.200  Sum_probs=10.5

Q ss_pred             cccccccCCCcceeecCCC
Q 000243          994 RSTTSRCDSQSSLSVSSAP 1012 (1800)
Q Consensus       994 r~~~~~~~sqsslsvsspp 1012 (1800)
                      |-..-+|.|-.+-.|=||-
T Consensus       380 sA~g~k~asDwtrvvfSpd  398 (459)
T KOG0288|consen  380 SAEGFKCASDWTRVVFSPD  398 (459)
T ss_pred             eccccccccccceeEECCC
Confidence            3344556666666665553


No 72 
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=61.26  E-value=50  Score=42.08  Aligned_cols=10  Identities=30%  Similarity=0.531  Sum_probs=5.2

Q ss_pred             CCCccccccc
Q 000243          291 SDWADDERDT  300 (1800)
Q Consensus       291 sdwadderdt  300 (1800)
                      ..|-+|..+-
T Consensus        63 ~~~r~~~~~~   72 (460)
T KOG1363|consen   63 FNYRDDNVDV   72 (460)
T ss_pred             hcccccCCCc
Confidence            5555555543


No 73 
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms]
Probab=61.03  E-value=34  Score=43.43  Aligned_cols=8  Identities=0%  Similarity=-0.492  Sum_probs=3.4

Q ss_pred             CCCCCCcc
Q 000243          503 NDPMHNFS  510 (1800)
Q Consensus       503 nDP~~~F~  510 (1800)
                      +++++|+.
T Consensus       216 ~~~llw~~  223 (460)
T KOG1363|consen  216 ENFLLWGW  223 (460)
T ss_pred             hceeeecc
Confidence            34444443


No 74 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=60.81  E-value=12  Score=46.68  Aligned_cols=8  Identities=25%  Similarity=0.264  Sum_probs=3.3

Q ss_pred             ccccccCC
Q 000243          785 TQDAENGH  792 (1800)
Q Consensus       785 pqd~eNG~  792 (1800)
                      -|.+-+++
T Consensus       345 rq~~~i~~  352 (506)
T KOG2507|consen  345 RQNQTIGL  352 (506)
T ss_pred             Hhcccccc
Confidence            34444443


No 75 
>PRK04863 mukB cell division protein MukB; Provisional
Probab=60.04  E-value=3.8e+02  Score=39.14  Aligned_cols=17  Identities=41%  Similarity=0.518  Sum_probs=9.7

Q ss_pred             CchhhhhHHHHHhhhhh
Q 000243         1200 SGILQETDKAIQDLVVQ 1216 (1800)
Q Consensus      1200 ~~~~~e~eka~q~l~i~ 1216 (1800)
                      -..++|++..|++|-|+
T Consensus      1033 ~e~L~E~eqe~~~~g~~ 1049 (1486)
T PRK04863       1033 RQMLQELKQELQDLGVP 1049 (1486)
T ss_pred             HHHHHHHHHHHHHcCCC
Confidence            33455566666666665


No 76 
>PF10168 Nup88:  Nuclear pore component;  InterPro: IPR019321  Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain []. Nup88 is over expressed in tumour cells []. 
Probab=59.07  E-value=1.3e+02  Score=40.52  Aligned_cols=15  Identities=20%  Similarity=0.441  Sum_probs=7.1

Q ss_pred             CcccccccccCCCCC
Q 000243           81 PSLRKEHERFDSSGS   95 (1800)
Q Consensus        81 pslrkeh~~~d~~~~   95 (1800)
                      |-+--.|-.+-++|.
T Consensus        83 ~~f~v~~i~~n~~g~   97 (717)
T PF10168_consen   83 PLFEVHQISLNPTGS   97 (717)
T ss_pred             CceeEEEEEECCCCC
Confidence            445555555544443


No 77 
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=59.04  E-value=4.3e+02  Score=33.74  Aligned_cols=7  Identities=57%  Similarity=0.881  Sum_probs=2.8

Q ss_pred             HHhhhhh
Q 000243          551 VKKKKDV  557 (1800)
Q Consensus       551 mKKKKEe  557 (1800)
                      +++++++
T Consensus       281 VRk~kE~  287 (672)
T KOG4722|consen  281 VRKKKEA  287 (672)
T ss_pred             HHHHHHH
Confidence            3344443


No 78 
>PF15359 CDV3:  Carnitine deficiency-associated protein 3
Probab=53.65  E-value=33  Score=37.03  Aligned_cols=63  Identities=29%  Similarity=0.421  Sum_probs=34.0

Q ss_pred             CCCCCCCccccccccccCcccCCCCccCCCCCCCCCcccccCCCCCcCC-CCCCccCCCccccccccc-CCCCccccccc
Q 000243          116 TGWTKPGTAVGSDQKINDKVDQGPHSVDGLSKGNDGVGVYVPPSVRSGT-VGPALSSFAPAEKASVLR-GEDFPSLQAAL  193 (1800)
Q Consensus       116 ~gw~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~-~~~~~~~~~~~e~~~vlr-gedfpsl~a~~  193 (1800)
                      .=|.|++++.......-  +...       --...++|||.||.+|-.. .-....+      |==|- =+-||||+||.
T Consensus        59 GPWnk~~~~~~~~~~~~--v~~~-------~~p~~~~gvY~PP~~R~~~~~r~~~qg------aPdI~Se~~FPSL~sta  123 (129)
T PF15359_consen   59 GPWNKSAPAQAPPAPAP--VEEP-------PEPATTSGVYRPPAARNTTTKRKRPQG------APDIFSEEQFPSLQSTA  123 (129)
T ss_pred             CCCcCCCCCCCCCCCCc--cCCC-------CCCCCCCceecCcccccccccCCCCCC------CCCccccccccchHHHh
Confidence            36999887544444432  1111       1135688999999999332 1111111      01111 24799999874


No 79 
>PTZ00491 major vault protein; Provisional
Probab=52.49  E-value=3e+02  Score=37.76  Aligned_cols=8  Identities=50%  Similarity=0.779  Sum_probs=4.6

Q ss_pred             CCcccccc
Q 000243          347 RDSETGKV  354 (1800)
Q Consensus       347 r~~~~g~~  354 (1800)
                      ||..+|||
T Consensus       389 rD~kTgkv  396 (850)
T PTZ00491        389 RNITTGEV  396 (850)
T ss_pred             EECCCCcE
Confidence            45566664


No 80 
>PF04094 DUF390:  Protein of unknown function (DUF390);  InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice. They have no known function. However they may be some kind of transposable element. There is a putative gypsy type transposon domain (IPR007321 from INTERPRO) towards the N terminus of the proteins.
Probab=51.21  E-value=6.4e+02  Score=34.41  Aligned_cols=29  Identities=17%  Similarity=0.139  Sum_probs=13.6

Q ss_pred             HHHHhhhccCCCCCCCCCCcCcCCCCCCccc
Q 000243          723 ERMVERITTSASSDSSGLHRSFDMSSRNQFA  753 (1800)
Q Consensus       723 eRmvERI~TSsSSdSSd~nrs~rsvsR~~tS  753 (1800)
                      -++.+.|-.-  ..++-+.++.+..-|+-++
T Consensus       671 lrl~~eigpg--~l~dav~rl~ragrrvgi~  699 (828)
T PF04094_consen  671 LRLTNEIGPG--QLSDAVSRLERAGRRVGIS  699 (828)
T ss_pred             HHhhcccCcc--hhhhHHHHHHhhccccccc
Confidence            3444444333  3455555555555555333


No 81 
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=50.91  E-value=6e+02  Score=35.02  Aligned_cols=13  Identities=38%  Similarity=0.580  Sum_probs=9.7

Q ss_pred             CCCCccccceeEE
Q 000243         1534 PRRPRRQRTEFRV 1546 (1800)
Q Consensus      1534 ~r~~~~~rtefrv 1546 (1800)
                      +++.+--|||||-
T Consensus      1197 ~~tvlaeRt~l~c 1209 (1265)
T KOG0976|consen 1197 PHTVLAERTELRC 1209 (1265)
T ss_pred             chhhhhhhhheee
Confidence            4567778999984


No 82 
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=50.86  E-value=6.7e+02  Score=32.40  Aligned_cols=9  Identities=11%  Similarity=0.198  Sum_probs=3.8

Q ss_pred             HHHHhhhhh
Q 000243          549 GVVKKKKDV  557 (1800)
Q Consensus       549 a~mKKKKEe  557 (1800)
                      ..+++|..+
T Consensus       225 ~flerkv~e  233 (502)
T KOG0982|consen  225 RFLERKVQE  233 (502)
T ss_pred             HHHHHHHHH
Confidence            334444443


No 83 
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=49.88  E-value=8.1e+02  Score=34.69  Aligned_cols=21  Identities=24%  Similarity=0.254  Sum_probs=9.8

Q ss_pred             CCCCCcchhhHHHHHHhhhhh
Q 000243          537 FDGRDPFSAGLVGVVKKKKDV  557 (1800)
Q Consensus       537 fDgrdpFa~~lla~mKKKKEe  557 (1800)
                      -+|..++...++..+.+-.+.
T Consensus       662 TGGs~~~~a~~L~~l~~l~~~  682 (1174)
T KOG0933|consen  662 TGGSRSKGADLLRQLQKLKQA  682 (1174)
T ss_pred             cCCCCCCcccHHHHHHHHHHH
Confidence            345555544455554444333


No 84 
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=48.70  E-value=1.1e+02  Score=39.95  Aligned_cols=16  Identities=19%  Similarity=0.331  Sum_probs=8.2

Q ss_pred             ccCccccccccccccc
Q 000243          469 QYGSEQYNRFRGDAFQ  484 (1800)
Q Consensus       469 ~ygi~qynr~rgdsfQ  484 (1800)
                      .||+.|-.-|...-+|
T Consensus       199 N~GG~qa~dYL~~Lmq  214 (645)
T KOG0681|consen  199 NWGGYQAGDYLSRLMQ  214 (645)
T ss_pred             ccCcchHHHHHHHHHh
Confidence            4555555555544443


No 85 
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=48.29  E-value=5.6e+02  Score=37.05  Aligned_cols=11  Identities=27%  Similarity=0.265  Sum_probs=4.6

Q ss_pred             ccccCCCCcee
Q 000243         1496 GLTSGSRGKRY 1506 (1800)
Q Consensus      1496 ~~~sg~rg~~y 1506 (1800)
                      +..|||.-++-
T Consensus      1246 ~~lSgGek~~~ 1256 (1353)
T TIGR02680      1246 GPASGGERALA 1256 (1353)
T ss_pred             cCCCchHHHHH
Confidence            33444444433


No 86 
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=47.96  E-value=34  Score=42.53  Aligned_cols=7  Identities=29%  Similarity=-0.021  Sum_probs=2.9

Q ss_pred             CCCcccc
Q 000243          448 QPWNNSV  454 (1800)
Q Consensus       448 Qpwn~~m  454 (1800)
                      |+++.||
T Consensus       190 qriIrmV  196 (506)
T KOG2441|consen  190 QRIIRMV  196 (506)
T ss_pred             hhhhhhh
Confidence            4444443


No 87 
>COG2433 Uncharacterized conserved protein [Function unknown]
Probab=46.76  E-value=5.5e+02  Score=34.38  Aligned_cols=12  Identities=25%  Similarity=0.351  Sum_probs=5.8

Q ss_pred             CCCcchhhHHHH
Q 000243          539 GRDPFSAGLVGV  550 (1800)
Q Consensus       539 grdpFa~~lla~  550 (1800)
                      .+|-.++++.++
T Consensus       343 ~RDALAAA~kAY  354 (652)
T COG2433         343 ERDALAAAYKAY  354 (652)
T ss_pred             HHHHHHHHHHHH
Confidence            334445555554


No 88 
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=46.42  E-value=33  Score=42.03  Aligned_cols=29  Identities=38%  Similarity=0.804  Sum_probs=22.7

Q ss_pred             ccccCCCCCCCcccccccccCCCCCCCCC
Q 000243           71 KLSVPPPLNLPSLRKEHERFDSSGSNGGP   99 (1800)
Q Consensus        71 klsvp~plnlpslrkeh~~~d~~~~~~~~   99 (1800)
                      .-.||||-..||.++-..-||.-|+-||.
T Consensus       310 nE~~ppppempswqqqq~~~~~~ggrggg  338 (465)
T KOG3973|consen  310 NEMVPPPPEMPSWQQQQHTFDRQGGRGGG  338 (465)
T ss_pred             ccCCCCCCCCCcHHHhcCCCCCCCCcCCC
Confidence            34589999999999998888887664433


No 89 
>PRK04863 mukB cell division protein MukB; Provisional
Probab=46.25  E-value=9.8e+02  Score=35.28  Aligned_cols=10  Identities=20%  Similarity=0.654  Sum_probs=5.3

Q ss_pred             cccccCCccc
Q 000243          867 ITERYGDVGW  876 (1800)
Q Consensus       867 igerfGd~gW  876 (1800)
                      +.-+|+|..|
T Consensus       759 v~~~~~~~~~  768 (1486)
T PRK04863        759 VVVKIADRQW  768 (1486)
T ss_pred             eeeeecchhh
Confidence            3445555555


No 90 
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=45.99  E-value=1.7e+02  Score=38.41  Aligned_cols=6  Identities=33%  Similarity=0.850  Sum_probs=2.9

Q ss_pred             ccCccc
Q 000243          469 QYGSEQ  474 (1800)
Q Consensus       469 ~ygi~q  474 (1800)
                      +|||..
T Consensus       149 ~yGIDs  154 (645)
T KOG0681|consen  149 AYGIDS  154 (645)
T ss_pred             eechhh
Confidence            455543


No 91 
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]
Probab=44.75  E-value=3.8e+02  Score=33.08  Aligned_cols=11  Identities=9%  Similarity=0.501  Sum_probs=4.5

Q ss_pred             ccccCcccccc
Q 000243          421 KFMSSPFRDTV  431 (1800)
Q Consensus       421 kYv~s~~r~~v  431 (1800)
                      -|+.+-|-.-+
T Consensus       120 dyidaQFEaYL  130 (406)
T KOG3859|consen  120 DYIDAQFEAYL  130 (406)
T ss_pred             HHHHHHHHHHH
Confidence            34444444333


No 92 
>PF05667 DUF812:  Protein of unknown function (DUF812);  InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function.
Probab=44.07  E-value=7.1e+02  Score=33.24  Aligned_cols=10  Identities=50%  Similarity=0.903  Sum_probs=5.6

Q ss_pred             ccccccccCC
Q 000243          187 PSLQAALPAA  196 (1800)
Q Consensus       187 psl~a~~p~~  196 (1800)
                      |++.+.||..
T Consensus        47 p~~~~~l~~~   56 (594)
T PF05667_consen   47 PSLGSSLPRS   56 (594)
T ss_pred             ccccCCCccc
Confidence            5665555553


No 93 
>PF06936 Selenoprotein_S:  Selenoprotein S (SelS);  InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. These proteins are involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins which participate in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner []. They probably serve as a linker between DER1, which mediates the retro-translocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.; GO: 0008430 selenium binding, 0006886 intracellular protein transport, 0030176 integral to endoplasmic reticulum membrane; PDB: 2Q2F_A.
Probab=43.31  E-value=1.4e+02  Score=34.18  Aligned_cols=6  Identities=0%  Similarity=0.063  Sum_probs=0.0

Q ss_pred             CCCccc
Q 000243          524 QDDPFM  529 (1800)
Q Consensus       524 ~EDp~M  529 (1800)
                      +|..++
T Consensus        17 ~~~~~~   22 (190)
T PF06936_consen   17 LENEDL   22 (190)
T ss_dssp             ------
T ss_pred             CcchhH
Confidence            344444


No 94 
>PRK12472 hypothetical protein; Provisional
Probab=42.81  E-value=4.1e+02  Score=34.61  Aligned_cols=10  Identities=0%  Similarity=-0.489  Sum_probs=5.5

Q ss_pred             ccCccccccc
Q 000243          469 QYGSEQYNRF  478 (1800)
Q Consensus       469 ~ygi~qynr~  478 (1800)
                      .|+||..+++
T Consensus       122 GiaIHGt~~p  131 (508)
T PRK12472        122 GIALHGGPLP  131 (508)
T ss_pred             eEEEecCCCC
Confidence            3566665543


No 95 
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=41.77  E-value=1.1e+03  Score=32.53  Aligned_cols=9  Identities=22%  Similarity=0.530  Sum_probs=4.8

Q ss_pred             CCccccccc
Q 000243          779 NSSTFITQD  787 (1800)
Q Consensus       779 ~SSaFlpqd  787 (1800)
                      ++-.|+|-+
T Consensus       573 gr~tflpl~  581 (1164)
T TIGR02169       573 GRATFLPLN  581 (1164)
T ss_pred             CCeeeccHh
Confidence            345566644


No 96 
>COG4499 Predicted membrane protein [Function unknown]
Probab=41.47  E-value=73  Score=39.87  Aligned_cols=20  Identities=25%  Similarity=0.331  Sum_probs=11.3

Q ss_pred             hhHHHHHHhhhhhhhccccc
Q 000243          545 AGLVGVVKKKKDVLKQTDFH  564 (1800)
Q Consensus       545 ~~lla~mKKKKEelKqaE~e  564 (1800)
                      ..+++.+|+..+..-....-
T Consensus       344 ~~~~Al~k~~eevksn~~ls  363 (434)
T COG4499         344 LTLLALTKLYEEVKSNTDLS  363 (434)
T ss_pred             hHHHHHHHHHHHHhcccCCC
Confidence            45567777766655433333


No 97 
>PLN03188 kinesin-12 family protein; Provisional
Probab=39.93  E-value=1.1e+03  Score=34.27  Aligned_cols=12  Identities=42%  Similarity=0.634  Sum_probs=6.0

Q ss_pred             CccccCCCCCCC
Q 000243           70 PKLSVPPPLNLP   81 (1800)
Q Consensus        70 ~klsvp~plnlp   81 (1800)
                      ++|-.|-|.+.|
T Consensus        65 ~~~~sp~p~~pp   76 (1320)
T PLN03188         65 AKLKSPLPPRPP   76 (1320)
T ss_pred             ccccCCCCCCCC
Confidence            444555555544


No 98 
>KOG3756 consensus Pinin (desmosome-associated protein) [Cytoskeleton]
Probab=39.48  E-value=8.6e+02  Score=30.38  Aligned_cols=14  Identities=14%  Similarity=0.159  Sum_probs=8.4

Q ss_pred             CCCCCceeeccccc
Q 000243          376 GREGNMWRASSSLQ  389 (1800)
Q Consensus       376 g~e~~~Wr~~sPl~  389 (1800)
                      |+.-++|+..+.+.
T Consensus        53 gr~r~~~~lr~~~~   66 (340)
T KOG3756|consen   53 GRGRGSLLLRRGFS   66 (340)
T ss_pred             cchhhhhhhhhhhh
Confidence            45555777776553


No 99 
>PRK12472 hypothetical protein; Provisional
Probab=39.06  E-value=6.5e+02  Score=32.98  Aligned_cols=7  Identities=43%  Similarity=0.923  Sum_probs=2.7

Q ss_pred             ccccCCC
Q 000243          909 RYSMRHP  915 (1800)
Q Consensus       909 ry~~rqp  915 (1800)
                      ||.-+||
T Consensus       481 ~~~~~~~  487 (508)
T PRK12472        481 RYPKPQP  487 (508)
T ss_pred             cCCCCCC
Confidence            3333333


No 100
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=38.34  E-value=7.2e+02  Score=35.61  Aligned_cols=11  Identities=27%  Similarity=0.172  Sum_probs=5.5

Q ss_pred             ccccccccccc
Q 000243          853 YGRNIEMESDF  863 (1800)
Q Consensus       853 ~gRq~eIdSdq  863 (1800)
                      +||..-|-++.
T Consensus       666 LgraTFi~LDk  676 (1293)
T KOG0996|consen  666 LGRATFIILDK  676 (1293)
T ss_pred             CCceeEEehHh
Confidence            55555554443


No 101
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=36.22  E-value=25  Score=43.03  Aligned_cols=19  Identities=47%  Similarity=0.835  Sum_probs=8.7

Q ss_pred             CCCCCCCCCCCCCCCCCCc
Q 000243           36 HSGYYGSNRARPTGGGGGG   54 (1800)
Q Consensus        36 ~~g~~~~~~~~~~~~~~gg   54 (1800)
                      +||+.|..+|.+||||+||
T Consensus       441 gggr~gggrgrgggggrg~  459 (465)
T KOG3973|consen  441 GGGRDGGGRGRGGGGGRGG  459 (465)
T ss_pred             CCCCCCCCCCCCCCCCCcc
Confidence            4444444444444445554


No 102
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=35.03  E-value=3e+02  Score=35.52  Aligned_cols=20  Identities=45%  Similarity=0.689  Sum_probs=9.2

Q ss_pred             CCCCCCCCCCCCCCCCCCce
Q 000243           36 HSGYYGSNRARPTGGGGGGM   55 (1800)
Q Consensus        36 ~~g~~~~~~~~~~~~~~ggm   55 (1800)
                      ++|+.+...+++|+++||||
T Consensus        71 ~s~~g~~s~~~gg~~~~~g~   90 (641)
T KOG3915|consen   71 GSGGGGGSSGNGGGGGGGGG   90 (641)
T ss_pred             CCCCCccccCCCCCCCCCCC
Confidence            33443444444455555555


No 103
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=34.69  E-value=2.7e+02  Score=35.82  Aligned_cols=8  Identities=50%  Similarity=0.580  Sum_probs=3.3

Q ss_pred             ccccccCC
Q 000243          177 KASVLRGE  184 (1800)
Q Consensus       177 ~~~vlrge  184 (1800)
                      |-|-|||-
T Consensus       178 KmVd~rG~  185 (641)
T KOG3915|consen  178 KMVDLRGA  185 (641)
T ss_pred             eeeeecCc
Confidence            33444443


No 104
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=34.08  E-value=1.5e+03  Score=32.69  Aligned_cols=6  Identities=33%  Similarity=0.457  Sum_probs=2.3

Q ss_pred             cccccC
Q 000243          786 QDAENG  791 (1800)
Q Consensus       786 qd~eNG  791 (1800)
                      .-+|+|
T Consensus       608 r~kesG  613 (1293)
T KOG0996|consen  608 RLKESG  613 (1293)
T ss_pred             HHHHcC
Confidence            333333


No 105
>PRK02292 V-type ATP synthase subunit E; Provisional
Probab=34.03  E-value=7e+02  Score=27.76  Aligned_cols=85  Identities=14%  Similarity=0.119  Sum_probs=0.0

Q ss_pred             CchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000243          565 DPVRESFEAELERVQKMQEQERQRIIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAE  644 (1800)
Q Consensus       565 dqeREElEaELErkrreeEEERrRkEEErKRreEEeRREEEERERkeREEEEErRReEEEeRErEErEEEERlEaERRaE  644 (1800)
                      ++.+.+.+++.++.....+++......+.+++.++...+..++.+++.....++.+.......+.......+.--..--+
T Consensus         8 ~~I~~~a~~e~~~I~~ea~~~~~~i~~ea~~~a~~i~~~~~~~a~~e~~~~~~r~~s~a~~~~rr~~L~~r~~~l~~v~~   87 (188)
T PRK02292          8 EDIRDEARARASEIRAEADEEAEEIIAEAEADAEEILEDREAEAEREIEQLREQELSSAKLEAKRERLNARKEVLEDVRN   87 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHH
Q 000243          645 EQRIA  649 (1800)
Q Consensus       645 EERKR  649 (1800)
                      +.+.+
T Consensus        88 ~a~~k   92 (188)
T PRK02292         88 QVEDE   92 (188)
T ss_pred             HHHHH


No 106
>KOG2668 consensus Flotillins [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=33.15  E-value=1e+03  Score=30.25  Aligned_cols=13  Identities=15%  Similarity=0.243  Sum_probs=6.2

Q ss_pred             ccccccCCCCCCC
Q 000243          488 ASKSSFSSGGRGF  500 (1800)
Q Consensus       488 ~sk~sFSlG~nGl  500 (1800)
                      |.+.++-+++.|+
T Consensus       130 feva~~dl~~mGi  142 (428)
T KOG2668|consen  130 FEVAQLDLGQMGI  142 (428)
T ss_pred             HHHhhhhhhhcce
Confidence            3344445555554


No 107
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=28.37  E-value=2.1e+03  Score=31.58  Aligned_cols=12  Identities=17%  Similarity=0.199  Sum_probs=5.1

Q ss_pred             hhHHHHhhhccC
Q 000243          721 DGERMVERITTS  732 (1800)
Q Consensus       721 D~eRmvERI~TS  732 (1800)
                      .+..++++....
T Consensus       760 ~Lq~~LEqe~~~  771 (1317)
T KOG0612|consen  760 KLQSMLEQEISK  771 (1317)
T ss_pred             HHHHHHHHHHHH
Confidence            444444444333


No 108
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]
Probab=28.26  E-value=1.8e+03  Score=30.85  Aligned_cols=22  Identities=32%  Similarity=0.613  Sum_probs=12.3

Q ss_pred             CCCCccceEEeeecccCCCCCCCCCcc
Q 000243         1270 LSQAETPVKLQFGLFSGPSLIPSPFPA 1296 (1800)
Q Consensus      1270 ~~~~e~pv~lqfglfsgpslipsp~pa 1296 (1800)
                      +.|++-|-++     -||.-|-|--|-
T Consensus       972 isqprNpsri-----agp~svtslE~m  993 (1265)
T KOG0976|consen  972 ISQPRNPSRI-----AGPKSVTSLEPM  993 (1265)
T ss_pred             eecCCCchhh-----cCcccccccccc
Confidence            4556655553     566666665443


No 109
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=27.30  E-value=8e+02  Score=30.14  Aligned_cols=12  Identities=8%  Similarity=0.183  Sum_probs=5.4

Q ss_pred             hhHHHHhhhccC
Q 000243          721 DGERMVERITTS  732 (1800)
Q Consensus       721 D~eRmvERI~TS  732 (1800)
                      ++......|...
T Consensus       338 el~~~a~~i~a~  349 (379)
T COG5269         338 ELGQLAADIKAE  349 (379)
T ss_pred             HHHHHHHHhhhh
Confidence            344444444443


No 110
>KOG2894 consensus Uncharacterized conserved protein XAP-5 [Function unknown]
Probab=27.13  E-value=3.6e+02  Score=32.96  Aligned_cols=125  Identities=19%  Similarity=0.191  Sum_probs=0.0

Q ss_pred             hhhHHHHHHhhhhhhhcccccCchhhHHHHHH----------------------------HHHHHHHHHHHHHHHHHHHH
Q 000243          544 SAGLVGVVKKKKDVLKQTDFHDPVRESFEAEL----------------------------ERVQKMQEQERQRIIEEQER  595 (1800)
Q Consensus       544 a~~lla~mKKKKEelKqaE~edqeREElEaEL----------------------------ErkrreeEEERrRkEEErKR  595 (1800)
                      ++-++..||+...+.++-+..++.-++-...-                            +.+.+.+..-+.|..+..++
T Consensus        11 agR~~~L~KkRE~qre~ie~~k~k~~e~~~~~~i~~kf~a~ydaVe~~lKssTvGLVtL~Dmk~kqeniVreRekqlak~   90 (331)
T KOG2894|consen   11 AGRAMHLMKKRERQREQIEQLKQKIAEENILKGIDNKFSAHYDAVEEELKSSTVGLVTLDDMKAKQENIVREREKQLAKK   90 (331)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhHhhhhhhhhhccccHHHHHHHHhhcccceEEHHHHHHHHHHHHHHHHHHHHHh


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHHH
Q 000243          596 ALELARREEEERLRVAREQEEQRRR---------LEEETREAVWRAEQEQLEA--------------TRKAEEQRIAREE  652 (1800)
Q Consensus       596 reEEeRREEEERERkeREEEEErRR---------eEEEeRErEErEEEERlEa--------------ERRaEEERKRkEE  652 (1800)
                      +....++++.+.++..++..+..+.         .++++...+.+..-.++..              ..+++++.+.+|+
T Consensus        91 ~~~k~q~k~~e~~~eKe~K~~kkr~~s~LSFa~DdEededD~~~k~~~~Kk~klGKdP~VDTSFLPDrEREeeEnr~RE~  170 (331)
T KOG2894|consen   91 KLSKTQQKKRELAREKEEKKEKKRQISRLSFALDDEEDEDDAEEKSIPLKKGKLGKDPDVDTSFLPDREREEEENRLREE  170 (331)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHhhccccccccccccccccccchhhcchhhhhcCCCCCcccccCCchhhHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHH
Q 000243          653 ERQRIIMEEERRKHAA  668 (1800)
Q Consensus       653 EeRRreEEEERRKEEE  668 (1800)
                      -++....++++-+-++
T Consensus       171 L~~eW~~~qe~~K~Ee  186 (331)
T KOG2894|consen  171 LRQEWEAKQEKIKNEE  186 (331)
T ss_pred             HHHHHHHHHHHhcCCc


No 111
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=27.07  E-value=2.6e+02  Score=36.31  Aligned_cols=10  Identities=50%  Similarity=0.547  Sum_probs=3.9

Q ss_pred             CCCCCceeec
Q 000243          376 GREGNMWRAS  385 (1800)
Q Consensus       376 g~e~~~Wr~~  385 (1800)
                      ||+|+.-.++
T Consensus       352 gr~G~Aivfl  361 (567)
T KOG0345|consen  352 GREGNAIVFL  361 (567)
T ss_pred             cCccceEEEe
Confidence            4444433333


No 112
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=26.94  E-value=5.9e+02  Score=31.22  Aligned_cols=7  Identities=57%  Similarity=1.227  Sum_probs=2.8

Q ss_pred             ccccCCC
Q 000243          274 QEEYFPG  280 (1800)
Q Consensus       274 ~~~~~~g  280 (1800)
                      ..+||-|
T Consensus        19 ~~~~f~~   25 (379)
T COG5269          19 HSEYFKG   25 (379)
T ss_pred             HHHHhcc
Confidence            3334443


No 113
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]
Probab=26.84  E-value=1.4e+03  Score=31.39  Aligned_cols=13  Identities=23%  Similarity=0.232  Sum_probs=9.9

Q ss_pred             cCCCCCCCCCccc
Q 000243          912 MRHPRVLPPPTLT  924 (1800)
Q Consensus       912 ~rqprvlppp~~~  924 (1800)
                      ||++-|+++|.-+
T Consensus       440 ~~~~~~~~~p~~~  452 (916)
T KOG0249|consen  440 MDRMGVMTLPSDL  452 (916)
T ss_pred             ccCCccccCcccc
Confidence            7888888888443


No 114
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]
Probab=26.45  E-value=1.4e+03  Score=31.85  Aligned_cols=15  Identities=33%  Similarity=0.410  Sum_probs=9.7

Q ss_pred             CCccccCCCCCCCccc
Q 000243           69 VPKLSVPPPLNLPSLR   84 (1800)
Q Consensus        69 ~~klsvp~plnlpslr   84 (1800)
                      --|-|--.|+| |-++
T Consensus       229 elkrSTel~in-PD~~  243 (1424)
T KOG4572|consen  229 ELKRSTELPIN-PDEK  243 (1424)
T ss_pred             hhccccccCCC-CCCc
Confidence            55666667777 6554


No 115
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=26.34  E-value=1.8e+03  Score=32.15  Aligned_cols=26  Identities=19%  Similarity=0.330  Sum_probs=16.3

Q ss_pred             ccCcccccccccCCCccCCCCCCCCC
Q 000243          423 MSSPFRDTVQDDSGRRDIDYGPGGRQ  448 (1800)
Q Consensus       423 v~s~~r~~v~dd~g~RD~GyG~~ggQ  448 (1800)
                      |+.-.+++.+-..+.|+.-.|+||=.
T Consensus       308 VSeeakdLI~~ll~~~e~RLgrngie  333 (1317)
T KOG0612|consen  308 VSEEAKDLIEALLCDREVRLGRNGIE  333 (1317)
T ss_pred             cCHHHHHHHHHHhcChhhhcccccHH
Confidence            45555666666666777667776643


No 116
>PF06658 DUF1168:  Protein of unknown function (DUF1168);  InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=26.06  E-value=5.1e+02  Score=28.88  Aligned_cols=15  Identities=27%  Similarity=0.399  Sum_probs=6.4

Q ss_pred             cccCCCCC-CCCCCcc
Q 000243          529 MKDFGSSS-FDGRDPF  543 (1800)
Q Consensus       529 MqDFgSSs-fDgrdpF  543 (1800)
                      +.+..+|+ .-|-..|
T Consensus        23 V~NV~GSSAGAGSGeF   38 (142)
T PF06658_consen   23 VRNVQGSSAGAGSGEF   38 (142)
T ss_pred             eccccccccccCccHH
Confidence            34444444 4454444


No 117
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]
Probab=24.93  E-value=1.6e+03  Score=29.12  Aligned_cols=13  Identities=8%  Similarity=0.284  Sum_probs=6.5

Q ss_pred             cccccccccccCc
Q 000243          475 YNRFRGDAFQRSS  487 (1800)
Q Consensus       475 ynr~rgdsfQnss  487 (1800)
                      +-+++|.++++..
T Consensus        40 ~sP~~~e~l~~rv   52 (552)
T KOG2129|consen   40 FSPSPGESLGARV   52 (552)
T ss_pred             CCCCCHHHHHHHH
Confidence            3445555555443


No 118
>KOG2505 consensus Ankyrin repeat protein [General function prediction only]
Probab=23.65  E-value=3.4e+02  Score=35.47  Aligned_cols=9  Identities=22%  Similarity=0.394  Sum_probs=4.9

Q ss_pred             CCccccccc
Q 000243          347 RDSETGKVS  355 (1800)
Q Consensus       347 r~~~~g~~~  355 (1800)
                      +|+--|++-
T Consensus       254 ~Da~gG~ah  262 (591)
T KOG2505|consen  254 HDAGGGAAH  262 (591)
T ss_pred             hhccCCccc
Confidence            555555544


No 119
>KOG2441 consensus mRNA splicing factor/probable chromatin binding snw family nuclear protein [RNA processing and modification; Chromatin structure and dynamics]
Probab=23.06  E-value=3.9e+02  Score=34.05  Aligned_cols=9  Identities=33%  Similarity=0.685  Sum_probs=5.1

Q ss_pred             Ccccccccc
Q 000243          471 GSEQYNRFR  479 (1800)
Q Consensus       471 gi~qynr~r  479 (1800)
                      +..||-+|.
T Consensus       170 a~s~YIryt  178 (506)
T KOG2441|consen  170 ADSQYIRYT  178 (506)
T ss_pred             CCcceeeec
Confidence            445666665


No 120
>PF08317 Spc7:  Spc7 kinetochore protein;  InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [].
Probab=21.41  E-value=1.5e+03  Score=27.58  Aligned_cols=157  Identities=18%  Similarity=0.223  Sum_probs=0.0

Q ss_pred             cccccCCCCCCCCCCcchhhHHHHHHhhhhhhhcccccCchhhHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000243          527 PFMKDFGSSSFDGRDPFSAGLVGVVKKKKDVLKQTDFHDPVRESFEAEL---ERVQKMQEQERQRIIEEQERALELARRE  603 (1800)
Q Consensus       527 p~MqDFgSSsfDgrdpFa~~lla~mKKKKEelKqaE~edqeREElEaEL---ErkrreeEEERrRkEEErKRreEEeRRE  603 (1800)
                      |.+..|.+++.+.+        ..|+.+-.-.|.-........-++.+.   +..+...++......+..+.-.+...+.
T Consensus       104 pLf~EY~~a~~d~r--------~~m~~q~~~vK~~aRl~aK~~WYeWR~~ll~gl~~~L~~~~~~L~~D~~~L~~~~~~l  175 (325)
T PF08317_consen  104 PLFREYYTADPDMR--------LLMDNQFQLVKTYARLEAKKMWYEWRMQLLEGLKEGLEENLELLQEDYAKLDKQLEQL  175 (325)
T ss_pred             HHHHHHHcCCHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000243          604 EEERLRVAREQEEQRRRLEEETREAV--WRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAAKQKLLELEERIAK  681 (1800)
Q Consensus       604 EEERERkeREEEEErRReEEEeRErE--ErEEEERlEaERRaEEERKRkEEEeRRreEEEERRKEEEEerRkEeEEEeKK  681 (1800)
                      .+-..+......+-+.+....+....  .....+.+++.+.+-......-++.++...+-+...++-+.+..+..+++.+
T Consensus       176 ~~~~~~l~~~~~~L~~e~~~Lk~~~~e~~~~D~~eL~~lr~eL~~~~~~i~~~k~~l~el~~el~~l~~~i~~~~~~k~~  255 (325)
T PF08317_consen  176 DELLPKLRERKAELEEELENLKQLVEEIESCDQEELEALRQELAEQKEEIEAKKKELAELQEELEELEEKIEELEEQKQE  255 (325)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHhcc
Q 000243          682 RQAEAAKSDS  691 (1800)
Q Consensus       682 rqaEkEK~rr  691 (1800)
                      .+.+.....+
T Consensus       256 l~~eI~e~~~  265 (325)
T PF08317_consen  256 LLAEIAEAEK  265 (325)
T ss_pred             HHHHHHHHHH


No 121
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=21.19  E-value=1.5e+03  Score=27.30  Aligned_cols=142  Identities=21%  Similarity=0.169  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000243          568 RESFEAELERVQKMQEQERQRIIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQR  647 (1800)
Q Consensus       568 REElEaELErkrreeEEERrRkEEErKRreEEeRREEEERERkeREEEEErRReEEEeRErEErEEEERlEaERRaEEER  647 (1800)
                      +..-..+.-++.+.+-+...+..+..+.+.+..+.+-..-+...++..++..+.++.........+...+..+....+++
T Consensus        25 ~~~~~~~~l~k~~~e~e~~~~~~~~~~~e~e~le~qv~~~e~ei~~~r~r~~~~e~kl~~v~~~~e~~aL~~E~~~ak~r  104 (239)
T COG1579          25 RIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKLSAVKDERELRALNIEIQIAKER  104 (239)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccchhccccccchhccc
Q 000243          648 IAREEERQRIIMEEERRKHAAKQKLLELEERIAKRQAEAAKSDSNSSDIADEKSSGLAKERD  709 (1800)
Q Consensus       648 KRkEEEeRRreEEEERRKEEEEerRkEeEEEeKKrqaEkEK~rrEAEakaeEKasaivkEKd  709 (1800)
                      ....+.+-....++....+.+.....+.-.+....-.+.+.....+-+...+.......++.
T Consensus       105 ~~~le~el~~l~~~~~~l~~~i~~l~~~~~~~e~~~~e~~~~~e~e~~~i~e~~~~~~~~~~  166 (239)
T COG1579         105 INSLEDELAELMEEIEKLEKEIEDLKERLERLEKNLAEAEARLEEEVAEIREEGQELSSKRE  166 (239)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


No 122
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]
Probab=21.12  E-value=1.9e+03  Score=28.59  Aligned_cols=13  Identities=31%  Similarity=0.284  Sum_probs=6.7

Q ss_pred             cCCCCCCCCCCcc
Q 000243          531 DFGSSSFDGRDPF  543 (1800)
Q Consensus       531 DFgSSsfDgrdpF  543 (1800)
                      +.-+++++..-|.
T Consensus       124 ~i~~~qt~~d~Pl  136 (447)
T KOG2751|consen  124 DILSSQTQVDHPL  136 (447)
T ss_pred             HHhhccCCcccch
Confidence            4444555555555


No 123
>PF07415 Herpes_LMP2:  Gammaherpesvirus latent membrane protein (LMP2) protein;  InterPro: IPR010881 This family consists of several Gammaherpesvirus latent membrane protein (LMP2) proteins. Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) is a human gammaherpesvirus that infects and establishes latency in B lymphocytes in vivo. The latent membrane protein 2 (LMP2) gene is expressed in latently infected B cells and encodes two protein isoforms, LMP2A and LMP2B, that are identical except for an additional N-terminal 119 aa cytoplasmic domain which is present in the LMP2A isoform. LMP2A is thought to play a key role in either the establishment or the maintenance of latency and/or the reactivation of productive infection from the latent state. The significance of LMP2B and its role in pathogenesis remain unclear [].; GO: 0019042 latent virus infection, 0033644 host cell membrane; PDB: 2JO9_B 1UXW_C.
Probab=20.60  E-value=34  Score=42.00  Aligned_cols=42  Identities=33%  Similarity=0.553  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccC
Q 000243           92 SSGSNGGPAGGGVSGAGQRPGSSGTGWTKPGTAVGSDQKIND  133 (1800)
Q Consensus        92 ~~~~~~~~~~~~~~g~g~~p~~sg~gw~kp~~~~~~~~~~~~  133 (1800)
                      .-+++|||-|+-|+++-.-|++.|.-|..|+.+..++.+.++
T Consensus        13 ~p~~~~~~dg~e~~~~~~~ps~~~~~~~~~~~p~~~d~~~~~   54 (489)
T PF07415_consen   13 PPSPHGGPDGYEGSNNSQYPSSFGSSWNSPGPPNYEDYPSNS   54 (489)
T ss_dssp             ------------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCcccCCCCC
Confidence            345677888888999999999999999999998888887764


No 124
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]
Probab=20.49  E-value=2e+03  Score=28.44  Aligned_cols=13  Identities=31%  Similarity=0.593  Sum_probs=7.2

Q ss_pred             cccccCCCCcccc
Q 000243          772 RDAFESGNSSTFI  784 (1800)
Q Consensus       772 Rd~~lrd~SSaFl  784 (1800)
                      +|-+-+++....|
T Consensus       187 sdtlatgg~Dr~I  199 (459)
T KOG0288|consen  187 SDTLATGGSDRII  199 (459)
T ss_pred             cchhhhcchhhhh
Confidence            4555555655555


No 125
>TIGR01144 ATP_synt_b ATP synthase, F0 subunit b. This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase.
Probab=20.32  E-value=1.1e+03  Score=25.24  Aligned_cols=96  Identities=20%  Similarity=0.168  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000243          589 IIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAA  668 (1800)
Q Consensus       589 kEEErKRreEEeRREEEERERkeREEEEErRReEEEeRErEErEEEERlEaERRaEEERKRkEEEeRRreEEEERRKEEE  668 (1800)
                      ..+.+..-.......++.+.+.....++-+++..+.+.++.+..++.+.++++..++.....+++..+..++.+...+.+
T Consensus        24 l~~R~~~I~~~l~~A~~~~~ea~~~~~e~~~~l~~A~~ea~~i~~~a~~~a~~~~~~~~~~a~~e~~~~~~~a~~~i~~e  103 (147)
T TIGR01144        24 IETRQKKIADGLASAERAKKEAALAQKKAQVILKEAKDEAQEIIENANKRGSEILEEAKAEAREEREKIKAQARAEIEAE  103 (147)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHH
Q 000243          669 KQKLLELEERIAKRQA  684 (1800)
Q Consensus       669 EerRkEeEEEeKKrqa  684 (1800)
                      +.+...+-........
T Consensus       104 ~~~a~~~l~~~~~~lA  119 (147)
T TIGR01144       104 KEQAREELRKQVADLS  119 (147)
T ss_pred             HHHHHHHHHHHHHHHH


No 126
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=20.25  E-value=1.1e+03  Score=25.56  Aligned_cols=96  Identities=18%  Similarity=0.085  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000243          589 IIEEQERALELARREEEERLRVAREQEEQRRRLEEETREAVWRAEQEQLEATRKAEEQRIAREEERQRIIMEEERRKHAA  668 (1800)
Q Consensus       589 kEEErKRreEEeRREEEERERkeREEEEErRReEEEeRErEErEEEERlEaERRaEEERKRkEEEeRRreEEEERRKEEE  668 (1800)
                      ..+.++.-.......++.+++.+...++-+.+.+..+.++.+.....+.++++..++.+...+++..+.....+...+.+
T Consensus        31 l~~R~~~I~~~l~~Ae~~~~eA~~~~~~~e~~L~~A~~ea~~ii~~A~~~a~~~~~~a~~~a~~~~~~~~~~a~~~I~~e  110 (159)
T PRK09173         31 LDARADRIKNELAEARRLREEAQQLLAEYQRKRKEAEKEAADIVAAAEREAEALTAEAKRKTEEYVARRNKLAEQKIAQA  110 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


Q ss_pred             HHHHHHHHHHHHHHHH
Q 000243          669 KQKLLELEERIAKRQA  684 (1800)
Q Consensus       669 EerRkEeEEEeKKrqa  684 (1800)
                      +++...+-......-.
T Consensus       111 k~~a~~el~~~~~~lA  126 (159)
T PRK09173        111 ETDAINAVRSSAVDLA  126 (159)
T ss_pred             HHHHHHHHHHHHHHHH


Done!