BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000273
         (1741 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IYK|G Chain G, Bluetongue Virus Structure Reveals A Sialic Acid Binding
           Dom Amphipathic Helices And A Central Coiled Coil In The
           Outer Proteins
 pdb|3IYK|I Chain I, Bluetongue Virus Structure Reveals A Sialic Acid Binding
           Dom Amphipathic Helices And A Central Coiled Coil In The
           Outer Proteins
 pdb|3IYK|K Chain K, Bluetongue Virus Structure Reveals A Sialic Acid Binding
           Dom Amphipathic Helices And A Central Coiled Coil In The
           Outer Proteins
          Length = 600

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 29  RLIKEELQRIKKADAALSGELTPYNIVPLEAPSLTNAIGFFPEVRGAISAIRYSEQFPRL 88
           R+  EE+ + +  D  +   L+P    P+E   LT  +  F ++R A+     S Q  + 
Sbjct: 531 RIKHEEIAQRQSDDPMVKRTLSPITADPIELQRLT--LARFYDIRPALRGQALSRQQAQS 588

Query: 89  PADFEISGQRD 99
             D EIS QRD
Sbjct: 589 TYDEEISKQRD 599


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,790,832
Number of Sequences: 62578
Number of extensions: 2087799
Number of successful extensions: 5691
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 5678
Number of HSP's gapped (non-prelim): 18
length of query: 1741
length of database: 14,973,337
effective HSP length: 112
effective length of query: 1629
effective length of database: 7,964,601
effective search space: 12974335029
effective search space used: 12974335029
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)