BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000341
         (1634 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2IUJ|A Chain A, Crystal Structure Of Soybean Lipoxygenase-B
          Length = 853

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 9/61 (14%)

Query: 607 CTDPNNPQSILL---DFISSCQNLRIW-SLNTSTREYLN-----NEQLQKGKQIDEWWRQ 657
             DP+ P  + L   D+  +   L IW ++ +   EY++     +E+LQK  ++  WW++
Sbjct: 606 VKDPSAPHGVRLLIEDYPYASDGLEIWDAIKSWVEEYVSFYYKSDEELQKDPELQAWWKE 665

Query: 658 V 658
           +
Sbjct: 666 L 666


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,169,452
Number of Sequences: 62578
Number of extensions: 1776965
Number of successful extensions: 3805
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3805
Number of HSP's gapped (non-prelim): 1
length of query: 1634
length of database: 14,973,337
effective HSP length: 112
effective length of query: 1522
effective length of database: 7,964,601
effective search space: 12122122722
effective search space used: 12122122722
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)