BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 000366
(1612 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3DGT|A Chain A, The 1.5 A Crystal Structure Of Endo-1,3-Beta-Glucanase
From Streptomyces Sioyaensis
Length = 280
Score = 31.2 bits (69), Expect = 5.2, Method: Composition-based stats.
Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 137 TFENMWDLTPDTDLLRELPEDYTFETALADLIDNSLQAVWTNAKNERRLISVNIA 191
T+ WD + + +R + T++T A+ +D A WTNA N + +N+A
Sbjct: 192 TYTMEWDRSVSPEAIRFSVDGVTYQTVTANQMD---AATWTNATNHGFFVILNVA 243
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.136 0.403
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,933,358
Number of Sequences: 62578
Number of extensions: 2116114
Number of successful extensions: 4905
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 4904
Number of HSP's gapped (non-prelim): 5
length of query: 1612
length of database: 14,973,337
effective HSP length: 112
effective length of query: 1500
effective length of database: 7,964,601
effective search space: 11946901500
effective search space used: 11946901500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)