BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000396
         (1576 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DGT|A Chain A, The 1.5 A Crystal Structure Of Endo-1,3-Beta-Glucanase
           From Streptomyces Sioyaensis
          Length = 280

 Score = 31.2 bits (69), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 137 TFENMWDLTPDTDLLRELPEDYTFETALADLIDNSLQAVWTNAKNERRLISVNIA 191
           T+   WD +   + +R   +  T++T  A+ +D    A WTNA N    + +N+A
Sbjct: 192 TYTMEWDRSVSPEAIRFSVDGVTYQTVTANQMD---AATWTNATNHGFFVILNVA 243


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.136    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,772,544
Number of Sequences: 62578
Number of extensions: 2069182
Number of successful extensions: 4851
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 4850
Number of HSP's gapped (non-prelim): 5
length of query: 1576
length of database: 14,973,337
effective HSP length: 112
effective length of query: 1464
effective length of database: 7,964,601
effective search space: 11660175864
effective search space used: 11660175864
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)