BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 000403
(1563 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2IUJ|A Chain A, Crystal Structure Of Soybean Lipoxygenase-B
Length = 853
Score = 32.3 bits (72), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 9/61 (14%)
Query: 536 CTDPNNPQSILL---DFISSCQNLRIWSLNTSTRE------YLNNEQLQKGKQIDEWWRQ 586
DP+ P + L D+ + L IW S E Y ++E+LQK ++ WW++
Sbjct: 606 VKDPSAPHGVRLLIEDYPYASDGLEIWDAIKSWVEEYVSFYYKSDEELQKDPELQAWWKE 665
Query: 587 V 587
+
Sbjct: 666 L 666
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.406
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,236,011
Number of Sequences: 62578
Number of extensions: 1695568
Number of successful extensions: 3664
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3664
Number of HSP's gapped (non-prelim): 1
length of query: 1563
length of database: 14,973,337
effective HSP length: 112
effective length of query: 1451
effective length of database: 7,964,601
effective search space: 11556636051
effective search space used: 11556636051
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)