BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000631
         (1381 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3E7W|A Chain A, Crystal Structure Of Dlta: Implications For The Reaction
            Mechanism Of Non-Ribosomal Peptide Synthetase (Nrps)
            Adenylation Domains
 pdb|3E7X|A Chain A, Crystal Structure Of Dlta: Implications For The Reaction
            Mechanism Of Non-Ribosomal Peptide Synthetase (Nrps)
            Adenylation Domains
          Length = 511

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 11/131 (8%)

Query: 1011 SGKLSRSLLDIDLNVPDERVLEDLASRSSAQDIVAASDLTNNLDGSRCEVMGSTSVR--- 1067
            S K     + +DL++P ER+ + + S S A+ ++ A+ L+ +  G + + + +  +    
Sbjct: 72   SVKAGHPYIPVDLSIPSERIAKIIES-SGAELLIHAAGLSIDAVGQQIQTVSAEELLENE 130

Query: 1068 -GSGGLDLDLNRAEEFIDISNYSTSNGNKTDVLVQTGTSSGGLSNGEVNVCRDFDLNDGP 1126
             GS   D  +   E F  I   S S GN   V +    S+  L +    +C DF ++ G 
Sbjct: 131  GGSVSQDQWVKEHETFYIIYT-SGSTGNPKGVQI----SAANLQSFTDWICADFPVSGGK 185

Query: 1127 VDDMNAEPTVF 1137
            +  +N  P  F
Sbjct: 186  I-FLNQAPFSF 195


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.128    0.368 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,810,767
Number of Sequences: 62578
Number of extensions: 1661362
Number of successful extensions: 2735
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 2733
Number of HSP's gapped (non-prelim): 8
length of query: 1381
length of database: 14,973,337
effective HSP length: 111
effective length of query: 1270
effective length of database: 8,027,179
effective search space: 10194517330
effective search space used: 10194517330
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 58 (26.9 bits)