BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000637
         (1378 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2E70|A Chain A, Solution Structure Of The Fifth Kow Motif Of Human
           Transcription Elongation Factor Spt5
          Length = 71

 Score = 31.2 bits (69), Expect = 3.8,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 250 VGQTLRIRVGPLKGYLCRVLAVRYSDVTVKLDSQQKILTVKGEHLAEV 297
           +GQT+RI  GP KGY+  V     S   V+L S  + ++V  + L  V
Sbjct: 20  IGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTV 67


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.305    0.127    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,911,323
Number of Sequences: 62578
Number of extensions: 1625991
Number of successful extensions: 1786
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 18
Number of HSP's that attempted gapping in prelim test: 1645
Number of HSP's gapped (non-prelim): 109
length of query: 1378
length of database: 14,973,337
effective HSP length: 111
effective length of query: 1267
effective length of database: 8,027,179
effective search space: 10170435793
effective search space used: 10170435793
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 58 (26.9 bits)