BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 000637
(1378 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2E70|A Chain A, Solution Structure Of The Fifth Kow Motif Of Human
Transcription Elongation Factor Spt5
Length = 71
Score = 31.2 bits (69), Expect = 3.8, Method: Composition-based stats.
Identities = 18/48 (37%), Positives = 26/48 (54%)
Query: 250 VGQTLRIRVGPLKGYLCRVLAVRYSDVTVKLDSQQKILTVKGEHLAEV 297
+GQT+RI GP KGY+ V S V+L S + ++V + L V
Sbjct: 20 IGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTV 67
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.305 0.127 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,911,323
Number of Sequences: 62578
Number of extensions: 1625991
Number of successful extensions: 1786
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 18
Number of HSP's that attempted gapping in prelim test: 1645
Number of HSP's gapped (non-prelim): 109
length of query: 1378
length of database: 14,973,337
effective HSP length: 111
effective length of query: 1267
effective length of database: 8,027,179
effective search space: 10170435793
effective search space used: 10170435793
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 58 (26.9 bits)