Query         000639
Match_columns 1378
No_of_seqs    435 out of 589
Neff          4.3 
Searched_HMMs 46136
Date          Mon Apr  1 21:06:57 2013
Command       hhsearch -i /work/01045/syshi/lefta3m/000639.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/leftcdd/000639hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1473 Nucleosome remodeling  100.0   3E-35 6.4E-40  356.4  23.4  276  764-1076  409-701 (1414)
  2 PF02791 DDT:  DDT domain;  Int  99.5 4.4E-14 9.6E-19  125.7   6.4   59  192-250     2-61  (61)
  3 smart00571 DDT domain in diffe  99.4 1.8E-13 3.8E-18  122.8   6.3   58  192-249     2-62  (63)
  4 KOG1245 Chromatin remodeling c  98.9 8.9E-09 1.9E-13  135.5  15.7   46  583-628   650-695 (1404)
  5 PF15613 WHIM2:  WSTF, HB1, Itc  98.9 1.1E-09 2.4E-14   89.7   3.8   37  766-802     1-37  (38)
  6 PF15614 WHIM3:  WSTF, HB1, Itc  98.7 1.3E-08 2.7E-13   86.5   4.0   36  805-840     1-37  (46)
  7 PF11600 CAF-1_p150:  Chromatin  98.5 5.4E-06 1.2E-10   91.0  19.6   63   97-178   154-216 (216)
  8 PF05066 HARE-HTH:  HB1, ASXL,   98.4 1.9E-07 4.1E-12   85.5   3.4   67  373-441     1-71  (72)
  9 PF15612 WHIM1:  WSTF, HB1, Itc  98.2 9.6E-07 2.1E-11   75.7   4.1   48  584-631     3-50  (50)
 10 KOG1029 Endocytic adaptor prot  98.2 3.6E-05 7.8E-10   94.6  17.0   25  576-600   719-744 (1118)
 11 KOG4364 Chromatin assembly fac  98.1 0.00011 2.3E-09   89.8  19.7   11  375-385   479-489 (811)
 12 PTZ00121 MAEBL; Provisional     98.1 8.9E-05 1.9E-09   95.7  19.4   12  804-815  1818-1829(2084)
 13 PTZ00266 NIMA-related protein   98.1 2.5E-05 5.5E-10  101.2  15.1   14  136-149   526-539 (1021)
 14 PTZ00121 MAEBL; Provisional     98.1 0.00014 3.1E-09   94.0  19.8   27  824-850  1793-1819(2084)
 15 KOG1029 Endocytic adaptor prot  98.0 0.00015 3.4E-09   89.3  18.5   21   37-57    352-372 (1118)
 16 PTZ00266 NIMA-related protein   98.0 7.4E-05 1.6E-09   97.1  15.5    8  386-393   721-728 (1021)
 17 PF11600 CAF-1_p150:  Chromatin  97.9 0.00035 7.6E-09   76.9  16.4   18   89-106   132-149 (216)
 18 KOG2891 Surface glycoprotein [  97.0    0.03 6.6E-07   63.4  17.2   22   90-111   389-410 (445)
 19 KOG2891 Surface glycoprotein [  96.9   0.068 1.5E-06   60.7  18.9   23   93-115   385-407 (445)
 20 KOG0163 Myosin class VI heavy   96.7   0.047   1E-06   68.3  16.8   25  210-234  1064-1089(1259)
 21 KOG1144 Translation initiation  96.6    0.03 6.4E-07   70.4  14.6   19  376-394   549-567 (1064)
 22 PF15236 CCDC66:  Coiled-coil d  96.5    0.12 2.7E-06   55.0  16.5   50   46-95     68-117 (157)
 23 PF05262 Borrelia_P83:  Borreli  96.4   0.075 1.6E-06   65.3  16.7    8  213-220   425-432 (489)
 24 KOG0163 Myosin class VI heavy   96.0   0.088 1.9E-06   66.0  14.2   25  117-141  1011-1035(1259)
 25 PRK09510 tolA cell envelope in  96.0    0.38 8.2E-06   57.9  18.9    9  299-307   305-313 (387)
 26 KOG1144 Translation initiation  95.8   0.065 1.4E-06   67.5  12.1   10 1115-1124  911-920 (1064)
 27 PF15236 CCDC66:  Coiled-coil d  95.4    0.76 1.6E-05   49.2  16.7   30   49-78     82-111 (157)
 28 PF05672 MAP7:  MAP7 (E-MAP-115  95.4     1.4 2.9E-05   47.9  18.6    7  137-143   151-157 (171)
 29 PF05672 MAP7:  MAP7 (E-MAP-115  95.1     1.7 3.7E-05   47.2  18.3    7  130-136   137-143 (171)
 30 KOG2412 Nuclear-export-signal   94.7    0.45 9.8E-06   58.6  14.2   15  298-312   521-535 (591)
 31 KOG3054 Uncharacterized conser  94.6    0.22 4.9E-06   56.0  10.5   10  217-226   216-225 (299)
 32 KOG3054 Uncharacterized conser  94.6    0.21 4.6E-06   56.2  10.3    9  220-228   204-212 (299)
 33 KOG2412 Nuclear-export-signal   93.4    0.63 1.4E-05   57.4  11.9   22  197-218   357-380 (591)
 34 PF13904 DUF4207:  Domain of un  92.9     9.9 0.00021   43.9  20.1    9  148-156   239-247 (264)
 35 COG3064 TolA Membrane protein   92.1     4.1 8.9E-05   47.8  15.5   13  300-312   311-323 (387)
 36 PF07888 CALCOCO1:  Calcium bin  91.7      10 0.00022   47.8  19.5   33  158-190   500-538 (546)
 37 PRK12704 phosphodiesterase; Pr  91.0      12 0.00027   47.0  19.4   16  212-227   278-293 (520)
 38 PRK00106 hypothetical protein;  90.8      17 0.00036   46.1  20.3   12  348-359   398-409 (535)
 39 PRK12704 phosphodiesterase; Pr  90.5      25 0.00054   44.4  21.4    6  353-358   388-393 (520)
 40 KOG0742 AAA+-type ATPase [Post  90.3      29 0.00063   42.8  20.5   19  614-632   599-617 (630)
 41 KOG2002 TPR-containing nuclear  88.0     3.2 6.8E-05   54.6  11.3   17   46-62    852-868 (1018)
 42 PF02029 Caldesmon:  Caldesmon;  87.6     2.6 5.6E-05   52.4  10.0   30  185-214   411-440 (492)
 43 PRK00106 hypothetical protein;  87.3      45 0.00097   42.4  20.4    6  354-359   381-386 (535)
 44 PF00769 ERM:  Ezrin/radixin/mo  84.6      68  0.0015   36.9  18.6    9  241-249   191-199 (246)
 45 KOG2689 Predicted ubiquitin re  84.4      23 0.00051   41.3  14.6   17  109-125   161-177 (290)
 46 KOG2689 Predicted ubiquitin re  81.6      16 0.00034   42.6  11.9   15  129-143   165-179 (290)
 47 PF09756 DDRGK:  DDRGK domain;   79.9    0.56 1.2E-05   51.5   0.0   40  203-247   100-140 (188)
 48 COG4942 Membrane-bound metallo  77.9      69  0.0015   39.7  16.3    8  292-299   410-417 (420)
 49 PF06524 NOA36:  NOA36 protein;  76.7     2.4 5.2E-05   48.5   3.7    7  949-955    38-44  (314)
 50 PF10147 CR6_interact:  Growth   76.4      78  0.0017   36.1  15.1   16   91-106   189-204 (217)
 51 KOG0579 Ste20-like serine/thre  72.4 2.9E+02  0.0063   36.4  19.8   16   44-59    842-857 (1187)
 52 PF02029 Caldesmon:  Caldesmon;  71.6      19  0.0004   45.2   9.8   11  217-227   389-399 (492)
 53 KOG3654 Uncharacterized CH dom  71.1      22 0.00049   44.1  10.0   27  284-316   625-651 (708)
 54 PRK12705 hypothetical protein;  69.4   3E+02  0.0066   35.1  19.5   12  348-359   371-382 (508)
 55 PRK13428 F0F1 ATP synthase sub  69.0      78  0.0017   39.3  14.3   24  162-185   148-171 (445)
 56 KOG0579 Ste20-like serine/thre  68.6 2.7E+02  0.0058   36.7  18.4   68    6-73    784-860 (1187)
 57 PLN03086 PRLI-interacting fact  67.8      27 0.00059   44.5  10.2   10  981-990   529-538 (567)
 58 PF09726 Macoilin:  Transmembra  66.7   4E+02  0.0088   35.3  20.4    8  131-138   642-649 (697)
 59 PF15346 ARGLU:  Arginine and g  66.7   2E+02  0.0043   31.3  17.8   13   29-41     34-46  (149)
 60 KOG3654 Uncharacterized CH dom  66.6      30 0.00066   43.0   9.8   15  232-246   509-523 (708)
 61 PF12072 DUF3552:  Domain of un  64.8 2.3E+02  0.0051   31.5  19.4   12   44-55     68-79  (201)
 62 KOG1832 HIV-1 Vpr-binding prot  64.7     3.6 7.8E-05   53.5   1.9   39  578-616   654-692 (1516)
 63 TIGR01069 mutS2 MutS2 family p  64.5 1.8E+02  0.0039   38.8  17.0   17  206-222   691-707 (771)
 64 PF06637 PV-1:  PV-1 protein (P  64.4      86  0.0019   38.3  12.7   58   83-140   316-375 (442)
 65 PTZ00491 major vault protein;   63.9 2.4E+02  0.0051   38.0  17.4   20   26-45    682-701 (850)
 66 KOG1832 HIV-1 Vpr-binding prot  63.6     3.9 8.5E-05   53.2   1.9   29  580-609   737-765 (1516)
 67 PLN03086 PRLI-interacting fact  62.4      42  0.0009   42.9  10.4   21  965-989   543-563 (567)
 68 TIGR01069 mutS2 MutS2 family p  62.2   2E+02  0.0043   38.4  16.8   11  293-303   697-707 (771)
 69 PF05918 API5:  Apoptosis inhib  61.9     2.6 5.6E-05   53.1   0.0   14  808-821   236-249 (556)
 70 COG4942 Membrane-bound metallo  61.4 4.1E+02   0.009   33.2  19.2   10  204-213   308-317 (420)
 71 PF09731 Mitofilin:  Mitochondr  61.0 4.5E+02  0.0098   33.5  19.2   11  331-341   519-529 (582)
 72 PRK00409 recombination and DNA  60.6 2.8E+02  0.0061   37.1  17.7   16  207-222   703-718 (782)
 73 PF10446 DUF2457:  Protein of u  59.4     6.6 0.00014   48.1   2.7   12 1354-1365   92-103 (458)
 74 KOG2253 U1 snRNP complex, subu  58.2 2.6E+02  0.0056   36.5  15.9   53  584-640   598-654 (668)
 75 PF09726 Macoilin:  Transmembra  58.0 5.7E+02   0.012   34.0  19.6   11  219-229   632-642 (697)
 76 KOG3859 Septins (P-loop GTPase  57.6 1.5E+02  0.0032   35.4  12.7    8  100-107   384-391 (406)
 77 KOG0742 AAA+-type ATPase [Post  55.9 5.2E+02   0.011   32.7  19.1    9  371-379   392-400 (630)
 78 KOG0577 Serine/threonine prote  55.9 6.1E+02   0.013   33.5  18.4    9  301-309   724-732 (948)
 79 KOG4848 Extracellular matrix-a  52.3   4E+02  0.0086   30.2  16.5   20   89-108   198-217 (225)
 80 PRK00409 recombination and DNA  51.6 4.6E+02    0.01   35.2  17.5   11  293-303   708-718 (782)
 81 PF15558 DUF4659:  Domain of un  50.2 5.9E+02   0.013   31.6  18.5    9  351-359   285-293 (376)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  49.7     4.9 0.00011   32.9  -0.3   26  949-974     2-36  (38)
 83 KOG3634 Troponin [Cytoskeleton  49.0 1.4E+02  0.0031   35.9  11.0    6  235-240   241-246 (361)
 84 KOG2507 Ubiquitin regulatory p  48.9      38 0.00083   41.7   6.7    9  292-300   408-416 (506)
 85 PF13913 zf-C2HC_2:  zinc-finge  48.3     5.1 0.00011   30.6  -0.3   23  964-990     3-25  (25)
 86 PRK15103 paraquat-inducible me  46.1      14  0.0003   45.5   2.6   29  946-974   218-246 (419)
 87 PF12128 DUF3584:  Protein of u  45.1 1.1E+03   0.023   33.4  20.1   31 1038-1068 1107-1143(1201)
 88 PF13719 zinc_ribbon_5:  zinc-r  44.4     7.3 0.00016   32.3  -0.0   25  949-973     2-35  (37)
 89 KOG3634 Troponin [Cytoskeleton  43.8 1.8E+02   0.004   35.0  10.9    8  197-204   239-246 (361)
 90 PF09731 Mitofilin:  Mitochondr  43.2 8.2E+02   0.018   31.3  21.5   17  231-247   494-510 (582)
 91 PF07888 CALCOCO1:  Calcium bin  43.1 8.7E+02   0.019   31.5  23.4   35  111-145   428-462 (546)
 92 TIGR00570 cdk7 CDK-activating   42.6 5.9E+02   0.013   30.7  14.9   10  214-223   285-294 (309)
 93 COG5242 TFB4 RNA polymerase II  42.6      10 0.00023   42.9   0.8   32  943-974   254-285 (296)
 94 KOG2507 Ubiquitin regulatory p  42.4      51  0.0011   40.7   6.3   12  289-300   423-434 (506)
 95 KOG3130 Uncharacterized conser  42.1      16 0.00034   44.4   2.2   44 1322-1365  262-307 (514)
 96 KOG0996 Structural maintenance  39.9 1.1E+03   0.024   33.3  17.9   15  346-360   652-666 (1293)
 97 PRK14474 F0F1 ATP synthase sub  37.3 7.1E+02   0.015   28.8  18.7   12  186-197   183-194 (250)
 98 KOG0161 Myosin class II heavy   37.2 1.3E+03   0.028   34.5  19.1   21 1102-1122 1801-1821(1930)
 99 COG2995 PqiA Uncharacterized p  37.2      19 0.00042   43.8   1.9   42  922-970   200-242 (418)
100 PF10446 DUF2457:  Protein of u  36.1      22 0.00049   43.7   2.2    6 1270-1275   13-18  (458)
101 TIGR00155 pqiA_fam integral me  36.1      25 0.00054   43.1   2.6   27  948-974   214-241 (403)
102 PRK04863 mukB cell division pr  36.0 1.6E+03   0.035   32.6  20.7    9  455-463   719-727 (1486)
103 PF09862 DUF2089:  Protein of u  35.7      23  0.0005   36.5   2.0   28  952-979     1-29  (113)
104 PF14943 MRP-S26:  Mitochondria  35.5 6.5E+02   0.014   27.9  15.2   23  124-146   134-156 (170)
105 PF06098 Radial_spoke_3:  Radia  35.4 5.1E+02   0.011   31.0  12.9   14  154-167   228-241 (291)
106 PRK06568 F0F1 ATP synthase sub  34.3 6.5E+02   0.014   27.5  15.3   16  105-120   102-117 (154)
107 PF04147 Nop14:  Nop14-like fam  33.5      44 0.00096   44.6   4.5    8 1247-1254  254-261 (840)
108 KOG0943 Predicted ubiquitin-pr  31.8      24 0.00051   47.7   1.5    9  617-625   938-946 (3015)
109 PF13717 zinc_ribbon_4:  zinc-r  31.6      17 0.00036   30.2   0.2   25  949-973     2-35  (36)
110 PF09736 Bud13:  Pre-mRNA-splic  30.6 4.2E+02  0.0091   28.5  10.3   22  128-149    66-87  (145)
111 PF10147 CR6_interact:  Growth   30.6 8.9E+02   0.019   28.0  14.2    8  109-116   199-206 (217)
112 TIGR00570 cdk7 CDK-activating   30.5 1.1E+03   0.023   28.8  17.6    9  235-243   292-300 (309)
113 PF09538 FYDLN_acid:  Protein o  29.6      26 0.00057   35.7   1.2   24  951-974    11-37  (108)
114 KOG0127 Nucleolar protein fibr  29.5      32 0.00069   43.4   2.1    9 1140-1148   25-33  (678)
115 PRK02363 DNA-directed RNA poly  28.9      62  0.0013   34.1   3.8   74  378-457     8-84  (129)
116 TIGR02680 conserved hypothetic  28.8 1.6E+03   0.034   32.3  18.0   30  277-309   489-518 (1353)
117 smart00017 OSTEO Osteopontin.   28.6      49  0.0011   38.0   3.1   31 1289-1330   43-73  (287)
118 TIGR02680 conserved hypothetic  28.0 1.6E+03   0.034   32.3  17.7   28  438-471   607-634 (1353)
119 PF06098 Radial_spoke_3:  Radia  27.9 4.7E+02    0.01   31.3  11.0   10  116-125   210-219 (291)
120 KOG2038 CAATT-binding transcri  27.7      49  0.0011   43.4   3.3   82 1271-1362  859-949 (988)
121 KOG4691 Uncharacterized conser  27.6 9.6E+02   0.021   27.4  13.0   26  124-149   169-194 (227)
122 PF04931 DNA_pol_phi:  DNA poly  27.3      40 0.00087   44.5   2.6    9 1029-1037  507-515 (784)
123 PRK12585 putative monovalent c  27.2 1.4E+02   0.003   33.6   6.2   49   45-93    125-174 (197)
124 KOG0681 Actin-related protein   27.0 4.6E+02    0.01   33.9  11.1   12  417-428   591-602 (645)
125 PRK04863 mukB cell division pr  26.2 2.3E+03   0.049   31.3  20.8   21 1017-1037 1171-1191(1486)
126 KOG2229 Protein required for a  26.1      71  0.0015   40.4   4.1  104  292-427    48-152 (616)
127 PF12128 DUF3584:  Protein of u  25.5 2.1E+03   0.046   30.6  21.5   31  588-618  1115-1145(1201)
128 PLN02372 violaxanthin de-epoxi  24.9   1E+03   0.022   30.0  13.1   17   10-26    364-380 (455)
129 PLN02316 synthase/transferase   24.8 2.1E+02  0.0046   39.4   8.4   23  384-406   601-623 (1036)
130 PF05918 API5:  Apoptosis inhib  24.5      25 0.00054   44.7   0.0   10 1095-1104  457-466 (556)
131 PRK06568 F0F1 ATP synthase sub  24.3 9.5E+02   0.021   26.2  14.9    8   21-28     38-45  (154)
132 PF14943 MRP-S26:  Mitochondria  24.2   1E+03   0.022   26.5  12.8   30  136-165   128-157 (170)
133 PF06409 NPIP:  Nuclear pore co  23.8 1.1E+03   0.025   27.6  12.4   26  142-167   202-227 (265)
134 TIGR02300 FYDLN_acid conserved  23.8      39 0.00085   35.6   1.2    6 1353-1358  117-122 (129)
135 PRK11637 AmiB activator; Provi  22.8 1.5E+03   0.032   27.9  21.6    6  294-299   420-425 (428)
136 TIGR03321 alt_F1F0_F0_B altern  22.3 1.2E+03   0.026   26.7  15.1   90   25-115    35-124 (246)
137 COG3909 Cytochrome c556 [Energ  21.3      19 0.00041   38.2  -1.6   11  912-922    91-101 (147)
138 KOG0161 Myosin class II heavy   20.7 3.1E+03   0.067   30.9  19.4   14 1009-1022 1864-1877(1930)
139 PRK06266 transcription initiat  20.5      65  0.0014   35.4   2.2   30  948-977   116-150 (178)
140 KOG4722 Zn-finger protein [Gen  20.4 1.8E+03   0.039   27.9  15.5   13  161-173   480-492 (672)
141 PF12172 DUF35_N:  Rubredoxin-l  20.1      34 0.00074   28.0  -0.1   25  946-970     8-32  (37)

No 1  
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription]
Probab=100.00  E-value=3e-35  Score=356.42  Aligned_cols=276  Identities=13%  Similarity=0.083  Sum_probs=201.1

Q ss_pred             ccccCCCCccCCCCceeecccCCCCCCCCCceeEEEecCc--cEEEecCHHHHHHHHHhccccchhHHHHHHHHHHHHHH
Q 000639          764 VYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDG--TWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETS  841 (1378)
Q Consensus       764 ~~R~~pLG~DR~~nRYW~f~~~~~~~dp~~grifVE~~dg--~W~~y~t~eeLd~Ll~~Ld~RG~RE~~L~~~L~k~~~~  841 (1378)
                      .||+.|+|.||+.+.||++          ..||+||+.|+  .| ||+|.-+|..||.+||.- .=|+.|+..+..+.+.
T Consensus       409 ~iR~~~iG~dr~gr~ywfi----------~rrl~Ie~~det~l~-yysT~pqly~ll~cLd~~-~~e~~L~d~i~~~~ee  476 (1414)
T KOG1473|consen  409 SIRHTPIGRDRYGRKYWFI----------SRRLRIEGMDETLLW-YYSTCPQLYHLLRCLDRT-YVEMYLCDGIWERREE  476 (1414)
T ss_pred             ceeccCCCcCccccchhce----------eeeeEEecCCCcEEE-EecCcHHHHHHHHHhchH-HHHHhhccchhhhHHH
Confidence            3799999999999999999          66999999988  66 999999999999999843 4688888888875555


Q ss_pred             HHHHHHhhccCccc--cCcchhhh--hcccccccCCCCC-----------CCCCCCCCCccCCCCCcccCccchhhhccc
Q 000639          842 FKDKVRRNLQGIDT--VGQSWTAI--KNEAAEMDVDPDF-----------ASSDSPSSTVCGLNSDTLETSSSFRIELGR  906 (1378)
Q Consensus       842 i~e~m~k~~~~~~~--~~~~~~~~--~n~~~e~~~~~~~-----------~~~~sp~s~~~~~~~d~~~~s~s~~iElgr  906 (1378)
                      |-    ++|..|..  +...+.+.  ..-.+...++-+|           .+..=|-+.|.++. +...++-+-+++- =
T Consensus       477 ~~----rqM~lT~~ltne~R~~~~f~~~~h~r~~l~~~c~~~lv~~iq~~~da~l~e~~l~~i~-k~v~~~~S~s~~~-e  550 (1414)
T KOG1473|consen  477 II----RQMGLTEELTNELRGAVDFGEDPHGRLFLGRDCAVLLVLCIQVVEDAILKEENLGDID-KVVLVLISASAHQ-E  550 (1414)
T ss_pred             HH----HhccchhhhhhhhhcccccccCCCcceeeecchhhHHhhhhhhhhhhhhhHhhhcchH-hhhhhhhhcccch-H
Confidence            44    45544442  33332110  0000000000000           00000111111111 1111111111111 0


Q ss_pred             chHHHHHHHHhHHHHHHHHHhhhcccccchhhcchhhhhhhhcccchhhhcccccccCCCCccccccCCCCCCccccchh
Q 000639          907 NEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHS  986 (1378)
Q Consensus       907 ~~~E~~~~~~R~q~f~kWmw~~~~~~~~l~a~k~Gkk~~~~~l~~c~~c~~~y~~~e~hc~~cH~tf~~~dl~~~fs~h~  986 (1378)
                      .-.|...+.++|++.+  --|..+.+.  .+|.++++.|  .|.+++.......+.+..++.-|       +.++|++|+
T Consensus       551 E~~e~ck~is~~~d~p--~~n~~~~~e--~~~dqtf~~y--~ys~n~vse~~~~d~e~~dkk~~-------~~tkf~l~~  617 (1414)
T KOG1473|consen  551 EYVEICKAISQYWDLP--EGNLWRLRE--EGNDQTFMKY--YYSGNEVSEIFLTDSENADKKSH-------MQTKFALIT  617 (1414)
T ss_pred             HHHHHHHHHhhccccc--ccchhhhhh--cccccchhhh--cccCCchhhccCCchhhhccccc-------ccceecccc
Confidence            2345588999999998  777777877  8999999999  89999999999999999999999       889999999


Q ss_pred             hhhhhhhhcCcccccCCCCcchhHHHHHHHHHHHHHhcCChhhhhhhhhhhhhHHHHHhhcccCCHHHHHHHHHHHHhhh
Q 000639          987 IQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGI 1066 (1378)
Q Consensus       987 a~c~~K~~~~~~~~~~~~~~lp~~ir~LK~~L~~iEa~ip~eAL~~~W~~~~Rk~W~~~l~~ass~~ellqvL~~le~aI 1066 (1378)
                      + ..+++.++--+++..    ...+.++..+|...++.||.++++..|... -|.|...|+.|-++.+|.-.|..+..++
T Consensus       618 n-sd~~~~g~~~t~gt~----~~~~~~~~~t~~~~lSniP~s~~n~~w~~~-tkg~~lavs~A~~~~el~s~t~~~d~s~  691 (1414)
T KOG1473|consen  618 N-SDGVTAGNVTTYGTG----SQHKKLIARTLQQGLSNIPISYNNRKWPVY-TKGFELAVSAAADLAELSSETLEPDLSK  691 (1414)
T ss_pred             c-ccceeccccccccch----hhcchHHHhhhhhhhccCchHhhhccchhh-ccchhhhhhccchHHHHHHhhcccchhh
Confidence            9 889988763355555    678889999999999999999999999887 9999999999999999999999999999


Q ss_pred             cccccccccc
Q 000639         1067 KRSYLSSNFE 1076 (1378)
Q Consensus      1067 k~d~L~~~~~ 1076 (1378)
                      +..-..+.|+
T Consensus       692 ~~~~~~~~ss  701 (1414)
T KOG1473|consen  692 RSNAFKAASS  701 (1414)
T ss_pred             hhhhhccchh
Confidence            9888777666


No 2  
>PF02791 DDT:  DDT domain;  InterPro: IPR004022 This domain is predicted to be a DNA binding domain. The DDT domain is named after (DNA binding homeobox and Different Transcription factors). It is found in foetal Alzheimer antigen and several hypothetical and uncharacterised proteins.
Probab=99.48  E-value=4.4e-14  Score=125.72  Aligned_cols=59  Identities=58%  Similarity=0.936  Sum_probs=55.6

Q ss_pred             hhHHhHHHHHHHHHhhhhhcccCCCCHHHHHHHhhccCc-cHHHHHHHHHHHHHHhchhh
Q 000639          192 ENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHES-RLLGEIHLALLKSIIKDIED  250 (1378)
Q Consensus       192 e~vgdLLmVweFL~sF~~~L~LsPFTLDDf~qAL~~~ds-~LL~EIH~aLLk~ll~d~Ed  250 (1378)
                      ++|+++||||+||++|+++|+|+|||||+|++||.+.++ .||.|||++||++|+++.+|
T Consensus         2 ~~~~~~L~v~~Fl~~F~~~L~L~~ftlddf~~AL~~~~~~~ll~ei~~~LL~~l~~~~~d   61 (61)
T PF02791_consen    2 EAFGDLLMVWEFLNTFGEVLGLSPFTLDDFEQALLCNDPSGLLAEIHCALLKALLADEED   61 (61)
T ss_pred             cHHHHHHHHHHHHHHHHHHHcCCcCCHHHHHHHHcCCCcchhHHHHHHHHHHHHHhccCC
Confidence            689999999999999999999999999999999999766 49999999999999999874


No 3  
>smart00571 DDT domain in different transcription and chromosome remodeling factors.
Probab=99.43  E-value=1.8e-13  Score=122.81  Aligned_cols=58  Identities=45%  Similarity=0.837  Sum_probs=55.0

Q ss_pred             hhHHhHHHHHHHHHhhhhhcccCCCC--HHHHHHHhhccCc-cHHHHHHHHHHHHHHhchh
Q 000639          192 ENVGNLLMVWRFFITFADVLGLWPFT--LDEFVQAFHDHES-RLLGEIHLALLKSIIKDIE  249 (1378)
Q Consensus       192 e~vgdLLmVweFL~sF~~~L~LsPFT--LDDf~qAL~~~ds-~LL~EIH~aLLk~ll~d~E  249 (1378)
                      +.|+++||||+||++|+++|+|+||+  ||+|++||.+.++ .||++||++||++|+++++
T Consensus         2 ~~~~d~l~V~eFl~~F~~~L~L~~f~~~l~~f~~Al~~~~~~~ll~ei~~~LL~~i~~d~~   62 (63)
T smart00571        2 EAFGDLLMVYEFLRSFGKVLGLSPFRATLEDFIAALKCRDQNGLLTEVHVVLLRAILKDEG   62 (63)
T ss_pred             cHHHHHHHHHHHHHHHHHHhCCCcchhhHHHHHHHHhcCCcchHHHHHHHHHHHHHHhCCC
Confidence            67999999999999999999999999  9999999999776 5999999999999999875


No 4  
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics]
Probab=98.92  E-value=8.9e-09  Score=135.54  Aligned_cols=46  Identities=22%  Similarity=0.076  Sum_probs=42.7

Q ss_pred             cchhHhhhhcccccCCCHHHHHHHHHHHHHHHhcchhHHHHHHHHH
Q 000639          583 GESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRL  628 (1378)
Q Consensus       583 GE~Wl~~L~~g~Y~~LsieeKL~iL~~Lv~~ll~sssVR~~Iderl  628 (1378)
                      ++.-+.-|.+..|.+|....|+.||..||+.++++..++.+|+.+.
T Consensus       650 ~~~~~~kl~~~~v~dl~~~~~~~il~~~~~~l~~~~e~~d~i~~~~  695 (1404)
T KOG1245|consen  650 HEELMEKLHTLLVFDLRAEEKDKILRQLCQRLLMLGEVVDHIEDRQ  695 (1404)
T ss_pred             hhhhhhhHHHHHHHhhhhhhhhhHHHHHHHHhccchhhhhhhhhHH
Confidence            6667888999999999999999999999999999999999999954


No 5  
>PF15613 WHIM2:  WSTF, HB1, Itc1p, MBD9 motif 2
Probab=98.90  E-value=1.1e-09  Score=89.65  Aligned_cols=37  Identities=46%  Similarity=0.744  Sum_probs=31.2

Q ss_pred             ccCCCCccCCCCceeecccCCCCCCCCCceeEEEecC
Q 000639          766 RSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHD  802 (1378)
Q Consensus       766 R~~pLG~DR~~nRYW~f~~~~~~~dp~~grifVE~~d  802 (1378)
                      |+.|||+||++||||||..+...+.+++++||||..+
T Consensus         1 R~~pLG~DR~~NrYwwf~~s~~~~~~~~~~~~v~~~~   37 (38)
T PF15613_consen    1 RLKPLGKDRYGNRYWWFSSSSSNSQYYNGGRFVEQGP   37 (38)
T ss_pred             CcccccccCCCceEEEEecccccCCCCCceEEEEeCC
Confidence            7899999999999999966555566788999999764


No 6  
>PF15614 WHIM3:  WSTF, HB1, Itc1p, MBD9 motif 3
Probab=98.70  E-value=1.3e-08  Score=86.45  Aligned_cols=36  Identities=42%  Similarity=0.675  Sum_probs=34.8

Q ss_pred             EEEecCHHHHHHHHHhc-cccchhHHHHHHHHHHHHH
Q 000639          805 WRLIDTVEAFDALLSSL-DARGTRESHLRIMLQKIET  840 (1378)
Q Consensus       805 W~~y~t~eeLd~Ll~~L-d~RG~RE~~L~~~L~k~~~  840 (1378)
                      |+||+++++||+|+.|| ||||+||++|+++|.+++.
T Consensus         1 W~~~~~~e~ld~L~~aL~~prG~RE~~L~~~L~~~~k   37 (46)
T PF15614_consen    1 WGYYDDPEELDELLKALENPRGKRESKLKKELDKHRK   37 (46)
T ss_pred             CccccCHHHHHHHHHHHcCcccHhHHHHHHHHHHHhc
Confidence            99999999999999999 9999999999999999883


No 7  
>PF11600 CAF-1_p150:  Chromatin assembly factor 1 complex p150 subunit, N-terminal;  InterPro: IPR021644  P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [].P150 is the HP1 interaction site of CAF-1 and lies within the N-terminal region of the protein []. 
Probab=98.53  E-value=5.4e-06  Score=90.97  Aligned_cols=63  Identities=27%  Similarity=0.270  Sum_probs=34.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhccCCccccccChhhhhccccccCCCCCCCCccc
Q 000639           97 LKEELRMEKQAAKRKVAIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTV  176 (1378)
Q Consensus        97 ~kEE~rreKEe~k~k~~~Ek~~~rr~are~a~l~edE~lEl~el~a~sk~l~S~~~Ld~etlqnlds~Rd~Lp~FPp~~V  176 (1378)
                      .++++++.|++++++.++++....            +.+.+..++..+.....+.       ...+++..|||||...+|
T Consensus       154 ~k~eek~~keeekr~~eE~~~~k~------------~q~~~~~FF~k~~~~~~~~-------~~~~~~~~f~pF~~k~~~  214 (216)
T PF11600_consen  154 AKEEEKRKKEEEKRKKEEEKRLKK------------EQARITSFFKKPKTPKAPK-------EKSDYEKKFLPFFVKDDM  214 (216)
T ss_pred             hHHHHHHHHHHHHHhhHHHHHHHH------------HHHHHHHHhCCCCCCCCCC-------ccchhhccccCceecCCc
Confidence            444555555555555544411111            1345667776544221211       335667889999998887


Q ss_pred             cc
Q 000639          177 RL  178 (1378)
Q Consensus       177 kL  178 (1378)
                      .|
T Consensus       215 ~l  216 (216)
T PF11600_consen  215 RL  216 (216)
T ss_pred             cC
Confidence            65


No 8  
>PF05066 HARE-HTH:  HB1, ASXL, restriction endonuclease HTH domain;  InterPro: IPR007759 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The delta protein is a dispensable subunit of Bacillus subtilis RNA polymerase (RNAP) that has major effects on the biochemical properties of the purified enzyme. In the presence of delta, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling []. The delta protein, contains two distinct regions, an N-terminal domain and a glutamate and aspartate residue-rich C-terminal region [].; GO: 0003677 DNA binding, 0006351 transcription, DNA-dependent; PDB: 2KRC_A.
Probab=98.39  E-value=1.9e-07  Score=85.46  Aligned_cols=67  Identities=37%  Similarity=0.543  Sum_probs=55.6

Q ss_pred             cchhHHHHHHHhhcCCCCccHHHHHHHhhhhccccCCCCCCchhhHHHhhccccc----hhhcccCcceeecc
Q 000639          373 GTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTK----LFERIAPSTYCVRP  441 (1378)
Q Consensus       373 gT~K~~~f~vls~~G~~gl~v~e~a~~~q~~~l~~~~t~~~~e~~i~~~ls~D~~----Lferiapsty~lr~  441 (1378)
                      +|++-+|++||...| ..|++.||++.|+..||.... +|+|.++|++.|.+|++    .|.++.|++|+||.
T Consensus         1 mt~~eaa~~vL~~~~-~pm~~~eI~~~i~~~~~~~~~-~k~p~~~i~a~ly~~~~~~d~~F~~vg~~~~~L~~   71 (72)
T PF05066_consen    1 MTFKEAAYEVLEEAG-RPMTFKEIWEEIQERGLYKKS-GKTPEATIAAQLYTDIKNEDSRFVKVGPGRWGLRS   71 (72)
T ss_dssp             S-HHHHHHHHHHHH--S-EEHHHHHHHHHHHHTS----GGGGGHHHH-HHHHHHH-T-SS-EESSSSEEE-GG
T ss_pred             CCHHHHHHHHHHhcC-CCcCHHHHHHHHHHhCCCCcc-cCCHHHHHHHHHHHHcccCCCCEEEeCCCcEEeee
Confidence            588999999999999 999999999999999998877 99999999999999998    99999999999983


No 9  
>PF15612 WHIM1:  WSTF, HB1, Itc1p, MBD9 motif 1; PDB: 2Y9Z_B 2Y9Y_B.
Probab=98.24  E-value=9.6e-07  Score=75.73  Aligned_cols=48  Identities=33%  Similarity=0.414  Sum_probs=41.3

Q ss_pred             chhHhhhhcccccCCCHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHH
Q 000639          584 ESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAA  631 (1378)
Q Consensus       584 E~Wl~~L~~g~Y~~LsieeKL~iL~~Lv~~ll~sssVR~~IderlEqa  631 (1378)
                      ..|+..|.++.|..|++++||.||++||+.+++++.||++|+++.|++
T Consensus         3 ~~~~~~l~~~~y~~L~~~~kl~iL~~L~~~~l~s~~vr~~i~~~~e~~   50 (50)
T PF15612_consen    3 PGLAPPLETGEYYELSPEEKLEILRALCDQLLSSSSVRNEIEEREEEQ   50 (50)
T ss_dssp             GGG-CCCCCSTCCCS-HHHHHHHHHHHHHHHCC-CCHHHHHHHHHT--
T ss_pred             hhhhHHHHcCCcccCCHHHHHHHHHHHHHHHcCcHHHHHHHHHhhccC
Confidence            568899999999999999999999999999999999999999999864


No 10 
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.18  E-value=3.6e-05  Score=94.59  Aligned_cols=25  Identities=24%  Similarity=0.442  Sum_probs=20.8

Q ss_pred             ccccCCCcch-hHhhhhcccccCCCH
Q 000639          576 EIDESKPGES-WIQGLAEGDYSHLSV  600 (1378)
Q Consensus       576 eiDes~~GE~-Wl~~L~~g~Y~~Lsi  600 (1378)
                      -+++++.||| |+.|=..|+++=.+-
T Consensus       719 ~V~esq~aEPGWlaGel~gktGWFPe  744 (1118)
T KOG1029|consen  719 IVFESQAAEPGWLAGELRGKTGWFPE  744 (1118)
T ss_pred             EEehhccCCcccccceeccccCcCcH
Confidence            3589999998 999999998887763


No 11 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=98.14  E-value=0.00011  Score=89.76  Aligned_cols=11  Identities=9%  Similarity=-0.079  Sum_probs=5.8

Q ss_pred             hhHHHHHHHhh
Q 000639          375 VKFAAFHVLSL  385 (1378)
Q Consensus       375 ~K~~~f~vls~  385 (1378)
                      +|+-+||.--+
T Consensus       479 mKaKlLqF~~N  489 (811)
T KOG4364|consen  479 MKAKLLQFDKN  489 (811)
T ss_pred             hHHHHhhhccc
Confidence            55555555443


No 12 
>PTZ00121 MAEBL; Provisional
Probab=98.12  E-value=8.9e-05  Score=95.71  Aligned_cols=12  Identities=25%  Similarity=0.169  Sum_probs=5.4

Q ss_pred             cEEEecCHHHHH
Q 000639          804 TWRLIDTVEAFD  815 (1378)
Q Consensus       804 ~W~~y~t~eeLd  815 (1378)
                      .|-+-|+++..+
T Consensus      1818 NLlv~~~~e~~~ 1829 (2084)
T PTZ00121       1818 NLVINDSKEMED 1829 (2084)
T ss_pred             cccccchhHHHH
Confidence            443344444444


No 13 
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=98.12  E-value=2.5e-05  Score=101.22  Aligned_cols=14  Identities=29%  Similarity=0.297  Sum_probs=7.0

Q ss_pred             HHHHHHHhccCCcc
Q 000639          136 ELMDLAAASKGLSS  149 (1378)
Q Consensus       136 El~el~a~sk~l~S  149 (1378)
                      +-..+....+++++
T Consensus       526 ~~~~~~~~~~~~~~  539 (1021)
T PTZ00266        526 NSYFLKGMENGLSA  539 (1021)
T ss_pred             hhhhhhhccccccc
Confidence            34444555555555


No 14 
>PTZ00121 MAEBL; Provisional
Probab=98.07  E-value=0.00014  Score=93.96  Aligned_cols=27  Identities=11%  Similarity=0.209  Sum_probs=15.5

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHhhc
Q 000639          824 RGTRESHLRIMLQKIETSFKDKVRRNL  850 (1378)
Q Consensus       824 RG~RE~~L~~~L~k~~~~i~e~m~k~~  850 (1378)
                      +..|..++.....++...|...|.+++
T Consensus      1793 s~aR~QqV~dEVdkY~AIIeqrIQqNL 1819 (2084)
T PTZ00121       1793 RMEVDKKIKDIFDNFANIIEGGKEGNL 1819 (2084)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhcc
Confidence            344556666666666555555555544


No 15 
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=98.04  E-value=0.00015  Score=89.26  Aligned_cols=21  Identities=43%  Similarity=0.626  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 000639           37 NEERMRKEMEKHERERRKEEE   57 (1378)
Q Consensus        37 ~EEr~rkE~Ek~erer~keeE   57 (1378)
                      +||..||++|++|.||+++.|
T Consensus       352 reE~ekkererqEqErk~qlE  372 (1118)
T KOG1029|consen  352 REEEEKKERERQEQERKAQLE  372 (1118)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            344445555555555555443


No 16 
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=97.99  E-value=7.4e-05  Score=97.09  Aligned_cols=8  Identities=38%  Similarity=0.920  Sum_probs=4.0

Q ss_pred             cCCCCccH
Q 000639          386 EGSKGLTV  393 (1378)
Q Consensus       386 ~G~~gl~v  393 (1378)
                      .|+.||.|
T Consensus       721 ~~~~~~~~  728 (1021)
T PTZ00266        721 KGNTGMNV  728 (1021)
T ss_pred             cCCCccee
Confidence            35555544


No 17 
>PF11600 CAF-1_p150:  Chromatin assembly factor 1 complex p150 subunit, N-terminal;  InterPro: IPR021644  P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [].P150 is the HP1 interaction site of CAF-1 and lies within the N-terminal region of the protein []. 
Probab=97.88  E-value=0.00035  Score=76.95  Aligned_cols=18  Identities=56%  Similarity=0.534  Sum_probs=7.1

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 000639           89 YLRAEKRRLKEELRMEKQ  106 (1378)
Q Consensus        89 ~er~Ek~r~kEE~rreKE  106 (1378)
                      .+++++.+.+++.+++++
T Consensus       132 ~ek~ek~~~kee~~kek~  149 (216)
T PF11600_consen  132 EEKAEKEREKEEKRKEKE  149 (216)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            333344444444444333


No 18 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=96.98  E-value=0.03  Score=63.37  Aligned_cols=22  Identities=36%  Similarity=0.531  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 000639           90 LRAEKRRLKEELRMEKQAAKRK  111 (1378)
Q Consensus        90 er~Ek~r~kEE~rreKEe~k~k  111 (1378)
                      .|++++.++++++-.-|+++-+
T Consensus       389 areerrkqkeeeklk~e~qkik  410 (445)
T KOG2891|consen  389 AREERRKQKEEEKLKAEEQKIK  410 (445)
T ss_pred             HHHHHHhhhHHHHHHHHHHHHH
Confidence            3344444444444444444333


No 19 
>KOG2891 consensus Surface glycoprotein [General function prediction only]
Probab=96.88  E-value=0.068  Score=60.70  Aligned_cols=23  Identities=35%  Similarity=0.356  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q 000639           93 EKRRLKEELRMEKQAAKRKVAIE  115 (1378)
Q Consensus        93 Ek~r~kEE~rreKEe~k~k~~~E  115 (1378)
                      ||.+.+|+.|++|+++|-++++.
T Consensus       385 ekieareerrkqkeeeklk~e~q  407 (445)
T KOG2891|consen  385 EKIEAREERRKQKEEEKLKAEEQ  407 (445)
T ss_pred             HHHHHHHHHHhhhHHHHHHHHHH
Confidence            45555666666666666666554


No 20 
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=96.65  E-value=0.047  Score=68.28  Aligned_cols=25  Identities=16%  Similarity=0.235  Sum_probs=15.0

Q ss_pred             hcccCCCCHHHHHHHhhcc-CccHHH
Q 000639          210 VLGLWPFTLDEFVQAFHDH-ESRLLG  234 (1378)
Q Consensus       210 ~L~LsPFTLDDf~qAL~~~-ds~LL~  234 (1378)
                      -..|+...+.+|-.++..+ |-.||.
T Consensus      1064 KYDl~~wkyaeLRDtINTS~DieLL~ 1089 (1259)
T KOG0163|consen 1064 KYDLSKWKYAELRDTINTSCDIELLE 1089 (1259)
T ss_pred             ccccccccHHHHHHhhcccccHHHHH
Confidence            3556667777777777653 334553


No 21 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=96.58  E-value=0.03  Score=70.40  Aligned_cols=19  Identities=21%  Similarity=0.179  Sum_probs=9.7

Q ss_pred             hHHHHHHHhhcCCCCccHH
Q 000639          376 KFAAFHVLSLEGSKGLTVL  394 (1378)
Q Consensus       376 K~~~f~vls~~G~~gl~v~  394 (1378)
                      ..+.|.-|-..|+.=|.++
T Consensus       549 ghEsFtnlRsrgsslC~~a  567 (1064)
T KOG1144|consen  549 GHESFTNLRSRGSSLCDLA  567 (1064)
T ss_pred             CchhhhhhhhccccccceE
Confidence            3555555555555544443


No 22 
>PF15236 CCDC66:  Coiled-coil domain-containing protein 66
Probab=96.48  E-value=0.12  Score=55.05  Aligned_cols=50  Identities=34%  Similarity=0.458  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000639           46 EKHERERRKEEERLMRERQREEERSLREQKREMERREKFLQKEYLRAEKR   95 (1378)
Q Consensus        46 Ek~erer~keeEr~ere~~~EEER~~rE~~rEeeR~eke~~kE~er~Ek~   95 (1378)
                      |...+.++.+++++.+|.+.|++|+.+++.....+.+.+.++.+++++..
T Consensus        68 eEk~r~k~~E~err~~EE~~EE~Rl~rere~~q~~~E~E~~~~~~KEe~~  117 (157)
T PF15236_consen   68 EEKRRQKQEEEERRRREEEEEEERLAREREELQRQFEEEQRKQREKEEEQ  117 (157)
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33344444555555566666666766666665555555544444444333


No 23 
>PF05262 Borrelia_P83:  Borrelia P83/100 protein;  InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=96.44  E-value=0.075  Score=65.31  Aligned_cols=8  Identities=38%  Similarity=0.360  Sum_probs=3.9

Q ss_pred             cCCCCHHH
Q 000639          213 LWPFTLDE  220 (1378)
Q Consensus       213 LsPFTLDD  220 (1378)
                      |.|.||+-
T Consensus       425 id~~tLev  432 (489)
T PF05262_consen  425 IDPETLEV  432 (489)
T ss_pred             cCccccee
Confidence            34555543


No 24 
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]
Probab=96.01  E-value=0.088  Score=66.02  Aligned_cols=25  Identities=20%  Similarity=0.207  Sum_probs=14.3

Q ss_pred             HHHHHHHHHhhhhhHHHHHHHHHHH
Q 000639          117 ATARKMAKESMDLIEDEQLELMDLA  141 (1378)
Q Consensus       117 ~~~rr~are~a~l~edE~lEl~el~  141 (1378)
                      +.+-|.|.....+|+|+--.++.+.
T Consensus      1011 ~la~RlA~sd~~~v~d~~~~~~~~v 1035 (1259)
T KOG0163|consen 1011 ELALRLANSDGGQVEDSPPVIRALV 1035 (1259)
T ss_pred             HHHHHHhhccCCccccccHHHHhhc
Confidence            3445566666667777655444443


No 25 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=95.96  E-value=0.38  Score=57.88  Aligned_cols=9  Identities=0%  Similarity=0.095  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 000639          299 WHEIFRQLA  307 (1378)
Q Consensus       299 WPEILRq~l  307 (1378)
                      |.-+++..|
T Consensus       305 Y~a~Ira~I  313 (387)
T PRK09510        305 YAGQIKSAI  313 (387)
T ss_pred             HHHHHHHHH
Confidence            334444433


No 26 
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Probab=95.81  E-value=0.065  Score=67.53  Aligned_cols=10  Identities=30%  Similarity=0.375  Sum_probs=4.3

Q ss_pred             cccccccCCC
Q 000639         1115 DASIMYVKPE 1124 (1378)
Q Consensus      1115 Da~I~y~~~~ 1124 (1378)
                      |+-..|...-
T Consensus       911 D~f~~y~e~~  920 (1064)
T KOG1144|consen  911 DAFTKYIEEI  920 (1064)
T ss_pred             HHHHHHHHHH
Confidence            4444444433


No 27 
>PF15236 CCDC66:  Coiled-coil domain-containing protein 66
Probab=95.42  E-value=0.76  Score=49.23  Aligned_cols=30  Identities=40%  Similarity=0.577  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000639           49 ERERRKEEERLMRERQREEERSLREQKREM   78 (1378)
Q Consensus        49 erer~keeEr~ere~~~EEER~~rE~~rEe   78 (1378)
                      .++...|++|..+++...+.+.+.++.+..
T Consensus        82 ~~EE~~EE~Rl~rere~~q~~~E~E~~~~~  111 (157)
T PF15236_consen   82 RREEEEEEERLAREREELQRQFEEEQRKQR  111 (157)
T ss_pred             HHHhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334444555555555555555554444333


No 28 
>PF05672 MAP7:  MAP7 (E-MAP-115) family;  InterPro: IPR008604 The organisation of microtubules varies with the cell type and is presumably controlled by tissue-specific microtubule-associated proteins (MAPs). The 115 kDa epithelial MAP (E-MAP-115) has been identified as a microtubule-stabilising protein predominantly expressed in cell lines of epithelial origin []. The binding of this microtubule associated protein is nucleotide independent [].
Probab=95.39  E-value=1.4  Score=47.94  Aligned_cols=7  Identities=14%  Similarity=0.240  Sum_probs=2.9

Q ss_pred             HHHHHHh
Q 000639          137 LMDLAAA  143 (1378)
Q Consensus       137 l~el~a~  143 (1378)
                      +|+--..
T Consensus       151 IMKRTRk  157 (171)
T PF05672_consen  151 IMKRTRK  157 (171)
T ss_pred             HHHHhcc
Confidence            4444333


No 29 
>PF05672 MAP7:  MAP7 (E-MAP-115) family;  InterPro: IPR008604 The organisation of microtubules varies with the cell type and is presumably controlled by tissue-specific microtubule-associated proteins (MAPs). The 115 kDa epithelial MAP (E-MAP-115) has been identified as a microtubule-stabilising protein predominantly expressed in cell lines of epithelial origin []. The binding of this microtubule associated protein is nucleotide independent [].
Probab=95.12  E-value=1.7  Score=47.19  Aligned_cols=7  Identities=57%  Similarity=0.691  Sum_probs=3.4

Q ss_pred             hHHHHHH
Q 000639          130 IEDEQLE  136 (1378)
Q Consensus       130 ~edE~lE  136 (1378)
                      .+.|+|+
T Consensus       137 ~eqERle  143 (171)
T PF05672_consen  137 EEQERLE  143 (171)
T ss_pred             HHHHHHH
Confidence            4445555


No 30 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=94.70  E-value=0.45  Score=58.60  Aligned_cols=15  Identities=27%  Similarity=0.448  Sum_probs=7.2

Q ss_pred             CHHHHHHHHHHHhCC
Q 000639          298 TWHEIFRQLALSAGF  312 (1378)
Q Consensus       298 TWPEILRq~llsaG~  312 (1378)
                      |--.||=.||.++||
T Consensus       521 ~tatll~s~Lq~aG~  535 (591)
T KOG2412|consen  521 TTATLLNSFLQTAGF  535 (591)
T ss_pred             hHHHHHHHHHHHHHH
Confidence            444444455555544


No 31 
>KOG3054 consensus Uncharacterized conserved protein [Function unknown]
Probab=94.63  E-value=0.22  Score=55.99  Aligned_cols=10  Identities=20%  Similarity=0.580  Sum_probs=4.9

Q ss_pred             CHHHHHHHhh
Q 000639          217 TLDEFVQAFH  226 (1378)
Q Consensus       217 TLDDf~qAL~  226 (1378)
                      .|+||..++.
T Consensus       216 ~ledLas~f~  225 (299)
T KOG3054|consen  216 PLEDLASEFG  225 (299)
T ss_pred             eHHHHHHHhC
Confidence            4455554444


No 32 
>KOG3054 consensus Uncharacterized conserved protein [Function unknown]
Probab=94.60  E-value=0.21  Score=56.15  Aligned_cols=9  Identities=33%  Similarity=0.623  Sum_probs=4.1

Q ss_pred             HHHHHhhcc
Q 000639          220 EFVQAFHDH  228 (1378)
Q Consensus       220 Df~qAL~~~  228 (1378)
                      ||++.+...
T Consensus       204 eFv~YIk~n  212 (299)
T KOG3054|consen  204 EFVEYIKKN  212 (299)
T ss_pred             HHHHHHHhc
Confidence            444444443


No 33 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=93.39  E-value=0.63  Score=57.41  Aligned_cols=22  Identities=9%  Similarity=0.125  Sum_probs=12.3

Q ss_pred             HHHHHHHHHhhhhhcc--cCCCCH
Q 000639          197 LLMVWRFFITFADVLG--LWPFTL  218 (1378)
Q Consensus       197 LLmVweFL~sF~~~L~--LsPFTL  218 (1378)
                      |..+.+-|.+|..--.  +.||-+
T Consensus       357 L~qI~dkl~s~~~~~~~~~~pl~~  380 (591)
T KOG2412|consen  357 LRQIFDKLDSLFGGIPDIVDPLAY  380 (591)
T ss_pred             HHHHHHHHHHHhcCCCCCCCchhH
Confidence            6677777766543333  444443


No 34 
>PF13904 DUF4207:  Domain of unknown function (DUF4207)
Probab=92.93  E-value=9.9  Score=43.86  Aligned_cols=9  Identities=0%  Similarity=0.076  Sum_probs=3.4

Q ss_pred             ccccccChh
Q 000639          148 SSIIHLDLE  156 (1378)
Q Consensus       148 ~S~~~Ld~e  156 (1378)
                      |.+.+-.|+
T Consensus       239 pvp~~~G~~  247 (264)
T PF13904_consen  239 PVPLNQGYD  247 (264)
T ss_pred             CCCcCCCCC
Confidence            333443333


No 35 
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]
Probab=92.14  E-value=4.1  Score=47.80  Aligned_cols=13  Identities=15%  Similarity=0.194  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHhCC
Q 000639          300 HEIFRQLALSAGF  312 (1378)
Q Consensus       300 PEILRq~llsaG~  312 (1378)
                      .+|-+.|+...-|
T Consensus       311 ~~Iq~rfl~~~sf  323 (387)
T COG3064         311 SAIQSRFLDADSF  323 (387)
T ss_pred             HHHHHHHhccccc
Confidence            3555666666555


No 36 
>PF07888 CALCOCO1:  Calcium binding and coiled-coil domain (CALCOCO1) like;  InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1 (Q61026 from SWISSPROT), and thus enhances transcriptional activation by a number of nuclear receptors. CoCoA has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region []. 
Probab=91.73  E-value=10  Score=47.80  Aligned_cols=33  Identities=21%  Similarity=0.354  Sum_probs=19.3

Q ss_pred             hhccccccC----CCCCCC--CcccccCCCCCCCCCCCC
Q 000639          158 LQNLDSFRD----SLSVFP--PKTVRLKRPFSVQPWSDS  190 (1378)
Q Consensus       158 lqnlds~Rd----~Lp~FP--p~~VkLkrP~ps~p~~vp  190 (1378)
                      |.+++.|-.    .+|++|  +..|.+.+|-|..|...|
T Consensus       500 l~~~~l~~~~~~~~~p~~p~~~~~vvi~qp~p~~~~~~~  538 (546)
T PF07888_consen  500 LGHYSLCEQGQPGSLPPSPREPERVVISQPAPISSQHQP  538 (546)
T ss_pred             CCCcCcccCCCCCCCCCCCCccccceeCCCCCCCCCCCC
Confidence            444555533    246777  335777888877755543


No 37 
>PRK12704 phosphodiesterase; Provisional
Probab=90.97  E-value=12  Score=47.00  Aligned_cols=16  Identities=19%  Similarity=0.424  Sum_probs=12.4

Q ss_pred             ccCCCCHHHHHHHhhc
Q 000639          212 GLWPFTLDEFVQAFHD  227 (1378)
Q Consensus       212 ~LsPFTLDDf~qAL~~  227 (1378)
                      .+.||..+++++....
T Consensus       278 ~i~P~~iee~~~~~~~  293 (520)
T PRK12704        278 RIHPARIEEMVEKARK  293 (520)
T ss_pred             CcCCCCHHHHHHHHHH
Confidence            5779999888887663


No 38 
>PRK00106 hypothetical protein; Provisional
Probab=90.85  E-value=17  Score=46.07  Aligned_cols=12  Identities=17%  Similarity=0.241  Sum_probs=6.1

Q ss_pred             hhHHHHHHHHhc
Q 000639          348 AENAFAWMREKG  359 (1378)
Q Consensus       348 ~~~~~~~m~~~G  359 (1378)
                      +.....+++++|
T Consensus       398 a~iGa~ll~~~~  409 (535)
T PRK00106        398 VEIGMEFARKYK  409 (535)
T ss_pred             HHHHHHHHHHcC
Confidence            344455555555


No 39 
>PRK12704 phosphodiesterase; Provisional
Probab=90.47  E-value=25  Score=44.42  Aligned_cols=6  Identities=0%  Similarity=0.025  Sum_probs=2.2

Q ss_pred             HHHHHh
Q 000639          353 AWMREK  358 (1378)
Q Consensus       353 ~~m~~~  358 (1378)
                      .++.++
T Consensus       388 ~il~~~  393 (520)
T PRK12704        388 ELAKKY  393 (520)
T ss_pred             HHHHHc
Confidence            333333


No 40 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=90.32  E-value=29  Score=42.78  Aligned_cols=19  Identities=0%  Similarity=0.057  Sum_probs=10.4

Q ss_pred             HhcchhHHHHHHHHHHHHH
Q 000639          614 ANEGNSIRAVLEDRLEAAN  632 (1378)
Q Consensus       614 ll~sssVR~~IderlEqa~  632 (1378)
                      +|+...+++.++..|++-+
T Consensus       599 vLd~~lf~e~v~ykv~eHq  617 (630)
T KOG0742|consen  599 VLDEALFDERVDYKVQEHQ  617 (630)
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            4455555666666665543


No 41 
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]
Probab=88.00  E-value=3.2  Score=54.58  Aligned_cols=17  Identities=47%  Similarity=0.644  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 000639           46 EKHERERRKEEERLMRE   62 (1378)
Q Consensus        46 Ek~erer~keeEr~ere   62 (1378)
                      +.++.+|++|||+..|+
T Consensus       852 ~~ee~~r~~eee~~~r~  868 (1018)
T KOG2002|consen  852 ELEEARRKEEEEKARRE  868 (1018)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            33333333333333333


No 42 
>PF02029 Caldesmon:  Caldesmon;  InterPro: IPR006018  This group of proteins includes two protein families: caldesmon and lymphocyte specific protein.  Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart). 
Probab=87.60  E-value=2.6  Score=52.40  Aligned_cols=30  Identities=13%  Similarity=0.101  Sum_probs=23.3

Q ss_pred             CCCCCChhhHHhHHHHHHHHHhhhhhcccC
Q 000639          185 QPWSDSEENVGNLLMVWRFFITFADVLGLW  214 (1378)
Q Consensus       185 ~p~~vp~e~vgdLLmVweFL~sF~~~L~Ls  214 (1378)
                      .++++|...|.+.-++|+-=++|+..-.-.
T Consensus       411 ~dlp~~~~~v~~~ks~we~g~v~~~~~~~~  440 (492)
T PF02029_consen  411 SDLPVPAEGVRSIKSMWEKGNVFSSSASKG  440 (492)
T ss_pred             ccCCcchHHHhhhhhhcccCCcccCCCCCC
Confidence            366777788999999999988888655443


No 43 
>PRK00106 hypothetical protein; Provisional
Probab=87.32  E-value=45  Score=42.43  Aligned_cols=6  Identities=17%  Similarity=0.827  Sum_probs=2.3

Q ss_pred             HHHHhc
Q 000639          354 WMREKG  359 (1378)
Q Consensus       354 ~m~~~G  359 (1378)
                      +|.--|
T Consensus       381 LLHDIG  386 (535)
T PRK00106        381 FLHDMG  386 (535)
T ss_pred             HHHhcc
Confidence            333333


No 44 
>PF00769 ERM:  Ezrin/radixin/moesin family;  InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []. Ezrin was first identified as a constituent of microvilli [], radixin as a barbed, end-capping actin-modulating protein from isolated junctional fractions [], and moesin as a heparin binding protein []. A tumour suppressor molecule responsible for neurofibromatosis type 2 (NF2) is highly similar to ERM proteins and has been designated merlin (moesin-ezrin-radixin-like protein). ERM molecules contain 3 domains, an N-terminal globular domain; an extended alpha-helical domain; and a charged C-terminal domain []. Ezrin, radixin and merlin also contain a polyproline region between the helical and C-terminal domains. The N-terminal domain is highly conserved, and is also found in merlin, band 4.1 proteins and members of the band 4.1 superfamily. ERM proteins crosslink actin filaments with plasma membranes. They co-localise with CD44 at actin filament-plasma membrane interaction sites, associating with CD44 via their N-terminal domains and with actin filaments via their C-terminal domains [].; GO: 0008092 cytoskeletal protein binding, 0005737 cytoplasm, 0019898 extrinsic to membrane; PDB: 2I1J_A 2I1K_A 1E5W_A 1EF1_C.
Probab=84.59  E-value=68  Score=36.89  Aligned_cols=9  Identities=33%  Similarity=0.641  Sum_probs=4.7

Q ss_pred             HHHHHhchh
Q 000639          241 LKSIIKDIE  249 (1378)
Q Consensus       241 Lk~ll~d~E  249 (1378)
                      |+.|-.+++
T Consensus       191 L~~L~~EL~  199 (246)
T PF00769_consen  191 LKELKSELE  199 (246)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            455555554


No 45 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=84.45  E-value=23  Score=41.26  Aligned_cols=17  Identities=29%  Similarity=0.266  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 000639          109 KRKVAIEKATARKMAKE  125 (1378)
Q Consensus       109 k~k~~~Ek~~~rr~are  125 (1378)
                      |-+++.++.+++|.|+.
T Consensus       161 RV~~~Ie~DKaeRka~~  177 (290)
T KOG2689|consen  161 RVLRQIERDKAERKAKY  177 (290)
T ss_pred             HHHHHHHHhHHHHHHHh
Confidence            33445555555555543


No 46 
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]
Probab=81.61  E-value=16  Score=42.59  Aligned_cols=15  Identities=20%  Similarity=0.087  Sum_probs=7.8

Q ss_pred             hhHHHHHHHHHHHHh
Q 000639          129 LIEDEQLELMDLAAA  143 (1378)
Q Consensus       129 l~edE~lEl~el~a~  143 (1378)
                      .|+.+..+.......
T Consensus       165 ~Ie~DKaeRka~~e~  179 (290)
T KOG2689|consen  165 QIERDKAERKAKYEN  179 (290)
T ss_pred             HHHHhHHHHHHHhcc
Confidence            355555555554443


No 47 
>PF09756 DDRGK:  DDRGK domain;  InterPro: IPR019153  This is a family of proteins of approximately 300 residues. They contain a highly conserved DDRGK motif. The function is unknown. ; PDB: 1WI9_A.
Probab=79.94  E-value=0.56  Score=51.54  Aligned_cols=40  Identities=8%  Similarity=0.249  Sum_probs=22.2

Q ss_pred             HHHhhhhhcccCC-CCHHHHHHHhhccCccHHHHHHHHHHHHHHhc
Q 000639          203 FFITFADVLGLWP-FTLDEFVQAFHDHESRLLGEIHLALLKSIIKD  247 (1378)
Q Consensus       203 FL~sF~~~L~LsP-FTLDDf~qAL~~~ds~LL~EIH~aLLk~ll~d  247 (1378)
                      +|..|-..+...- ..|+||...+.-.....+     .-|+.|..+
T Consensus       100 lL~~Fi~yIK~~Kvv~ledla~~f~l~t~~~i-----~ri~~L~~~  140 (188)
T PF09756_consen  100 LLQEFINYIKEHKVVNLEDLAAEFGLRTQDVI-----NRIQELEAE  140 (188)
T ss_dssp             HHHHHHHHHHH-SEE-HHHHHHHH-S-HHHHH-----HHHHHHHHH
T ss_pred             HHHHHHHHHHHcceeeHHHHHHHcCCCHHHHH-----HHHHHHHHC
Confidence            5666666676664 478998888877544333     444555544


No 48 
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=77.93  E-value=69  Score=39.66  Aligned_cols=8  Identities=50%  Similarity=1.095  Sum_probs=4.2

Q ss_pred             hcCCCCCH
Q 000639          292 QLLNPLTW  299 (1378)
Q Consensus       292 ~~LdslTW  299 (1378)
                      ..+||.+|
T Consensus       410 ~pvnP~pW  417 (420)
T COG4942         410 QPVNPQPW  417 (420)
T ss_pred             CcCCchhh
Confidence            44555555


No 49 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=76.72  E-value=2.4  Score=48.52  Aligned_cols=7  Identities=57%  Similarity=1.374  Sum_probs=3.0

Q ss_pred             cccchhh
Q 000639          949 LVICDVC  955 (1378)
Q Consensus       949 l~~c~~c  955 (1378)
                      .--|+-|
T Consensus        38 ~MeCdkC   44 (314)
T PF06524_consen   38 LMECDKC   44 (314)
T ss_pred             cccchhh
Confidence            3344444


No 50 
>PF10147 CR6_interact:  Growth arrest and DNA-damage-inducible proteins-interacting protein 1;  InterPro: IPR018472 Members of this family of proteins act as negative regulators of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occur also in the absence of GADD45 proteins. Furthermore, they act as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity []. They may be involved in the hormone-mediated regulation of NR4A1 transcriptional activity.; GO: 0007049 cell cycle, 0005634 nucleus
Probab=76.36  E-value=78  Score=36.10  Aligned_cols=16  Identities=38%  Similarity=0.569  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q 000639           91 RAEKRRLKEELRMEKQ  106 (1378)
Q Consensus        91 r~Ek~r~kEE~rreKE  106 (1378)
                      +++|+++++..++.|+
T Consensus       189 keeKKk~K~aKkk~k~  204 (217)
T PF10147_consen  189 KEEKKKKKEAKKKEKE  204 (217)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3444444433333333


No 51 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=72.36  E-value=2.9e+02  Score=36.37  Aligned_cols=16  Identities=44%  Similarity=0.605  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q 000639           44 EMEKHERERRKEEERL   59 (1378)
Q Consensus        44 E~Ek~erer~keeEr~   59 (1378)
                      |+|-.+|+++++-|+.
T Consensus       842 EmenlErqQkq~iE~~  857 (1187)
T KOG0579|consen  842 EMENLERQQKQEIEDT  857 (1187)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4444455555444433


No 52 
>PF02029 Caldesmon:  Caldesmon;  InterPro: IPR006018  This group of proteins includes two protein families: caldesmon and lymphocyte specific protein.  Caldesmon (CDM) is an actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and non-muscle cells, possibly acting as a bridge between myosin and actin filaments []. CDM is believed to be an elongated molecule, with an N-terminal myosin/calmodulin- binding domain and a C-terminal tropomyosin/actin/calmodulin-binding domain, separated by a 40nm-long central helix []. A high-molecular-weight form of CDM is predominantly expressed in smooth muscles, while a low-molecular-weight form is widely distributed in non- muscle tissues and cells (the protein is not expressed in skeletal muscle or heart). 
Probab=71.57  E-value=19  Score=45.22  Aligned_cols=11  Identities=18%  Similarity=0.540  Sum_probs=5.9

Q ss_pred             CHHHHHHHhhc
Q 000639          217 TLDEFVQAFHD  227 (1378)
Q Consensus       217 TLDDf~qAL~~  227 (1378)
                      .|+.+-.||..
T Consensus       389 rleqyt~a~~~  399 (492)
T PF02029_consen  389 RLEQYTSAIES  399 (492)
T ss_pred             hHHHHHHHhhc
Confidence            45555556553


No 53 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=71.14  E-value=22  Score=44.13  Aligned_cols=27  Identities=37%  Similarity=0.655  Sum_probs=13.9

Q ss_pred             ccchhhhhhcCCCCCHHHHHHHHHHHhCCCCcc
Q 000639          284 GFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKL  316 (1378)
Q Consensus       284 Gf~l~~w~~~LdslTWPEILRq~llsaG~g~~~  316 (1378)
                      ||.++   ..-..+|=+|.+|-.   .|.||..
T Consensus       625 ~cqfr---alyT~~~ETeei~kl---~gmgpk~  651 (708)
T KOG3654|consen  625 GCQFR---ALYTYMPETEEIRKL---TGMGPKM  651 (708)
T ss_pred             cceee---cccccCccHHHHhhh---hccCchh
Confidence            55443   345555666665543   2455554


No 54 
>PRK12705 hypothetical protein; Provisional
Probab=69.43  E-value=3e+02  Score=35.13  Aligned_cols=12  Identities=17%  Similarity=0.022  Sum_probs=7.0

Q ss_pred             hhHHHHHHHHhc
Q 000639          348 AENAFAWMREKG  359 (1378)
Q Consensus       348 ~~~~~~~m~~~G  359 (1378)
                      +.....+++++|
T Consensus       371 ~~iGaeLlkk~~  382 (508)
T PRK12705        371 VEIGAELARKFN  382 (508)
T ss_pred             HHHHHHHHHhcC
Confidence            344566666666


No 55 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=69.01  E-value=78  Score=39.34  Aligned_cols=24  Identities=29%  Similarity=0.560  Sum_probs=13.6

Q ss_pred             ccccCCCCCCCCcccccCCCCCCC
Q 000639          162 DSFRDSLSVFPPKTVRLKRPFSVQ  185 (1378)
Q Consensus       162 ds~Rd~Lp~FPp~~VkLkrP~ps~  185 (1378)
                      +.|-+.|..+||.+..+..|.++.
T Consensus       148 d~~i~~l~~~~~~~~~~~~~~~~~  171 (445)
T PRK13428        148 DRFLDELDAMAPSTADVDYPLLAK  171 (445)
T ss_pred             HHHHHHhhccCCCchhhcCchhhh
Confidence            334444555666666666666554


No 56 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=68.65  E-value=2.7e+02  Score=36.65  Aligned_cols=68  Identities=34%  Similarity=0.422  Sum_probs=29.2

Q ss_pred             hhhHHHHHHHHHHHH-HHHHHHHHHHHHHH-----HHHHHHHHH-HHHHH--HHHHHHHHHHHHHHHHHHHHHHHHH
Q 000639            6 KCDEARIAREVEANE-IRIQKELERQDNLR-----RKNEERMRK-EMEKH--ERERRKEEERLMRERQREEERSLRE   73 (1378)
Q Consensus         6 k~e~~r~~re~e~~e-~r~rkE~Ekqe~~r-----rk~EEr~rk-E~Ek~--erer~keeEr~ere~~~EEER~~rE   73 (1378)
                      |-++-|-.|..+..+ ++++||.-+++.+.     ...|+..|+ +.|.-  .|.-..|.|-.+|.++.+-|+.+.+
T Consensus       784 k~eemrflRrQeLreLR~LQkeE~R~qqqL~~k~~~q~Eq~~rrFeqE~~~kkr~~d~EmenlErqQkq~iE~~Eq~  860 (1187)
T KOG0579|consen  784 KDEEMRFLRRQELRELRRLQKEEARQQQQLQAKGIKQVEQQARRFEQEQTNKKRTSDLEMENLERQQKQEIEDTEQA  860 (1187)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            344555555554433 44555555554332     222222221 22222  2222334555555555555555443


No 57 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=67.81  E-value=27  Score=44.49  Aligned_cols=10  Identities=40%  Similarity=0.650  Sum_probs=5.4

Q ss_pred             cccchhhhhh
Q 000639          981 KFSEHSIQCE  990 (1378)
Q Consensus       981 ~fs~h~a~c~  990 (1378)
                      ....|..+|-
T Consensus       529 ~Lt~HE~~CG  538 (567)
T PLN03086        529 GMSEHESICG  538 (567)
T ss_pred             hHHHHHHhcC
Confidence            4555666553


No 58 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=66.71  E-value=4e+02  Score=35.33  Aligned_cols=8  Identities=38%  Similarity=0.347  Sum_probs=3.4

Q ss_pred             HHHHHHHH
Q 000639          131 EDEQLELM  138 (1378)
Q Consensus       131 edE~lEl~  138 (1378)
                      |.|..||.
T Consensus       642 d~ei~~lk  649 (697)
T PF09726_consen  642 DKEIEELK  649 (697)
T ss_pred             HHHHHHHH
Confidence            44444433


No 59 
>PF15346 ARGLU:  Arginine and glutamate-rich 1
Probab=66.69  E-value=2e+02  Score=31.30  Aligned_cols=13  Identities=38%  Similarity=0.496  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHHH
Q 000639           29 RQDNLRRKNEERM   41 (1378)
Q Consensus        29 kqe~~rrk~EEr~   41 (1378)
                      ..+..+|-++++.
T Consensus        34 ~~ei~rRvee~r~   46 (149)
T PF15346_consen   34 EKEIQRRVEEERK   46 (149)
T ss_pred             HHHHHHHHHHHHH
Confidence            3334444444433


No 60 
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton]
Probab=66.57  E-value=30  Score=43.05  Aligned_cols=15  Identities=33%  Similarity=0.392  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHh
Q 000639          232 LLGEIHLALLKSIIK  246 (1378)
Q Consensus       232 LL~EIH~aLLk~ll~  246 (1378)
                      -|.++|..||.+|-.
T Consensus       509 tl~sv~~~~lcaidq  523 (708)
T KOG3654|consen  509 TLESVHSGLLCAIDQ  523 (708)
T ss_pred             ChHhhhhhhhccccc
Confidence            366777776665543


No 61 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=64.77  E-value=2.3e+02  Score=31.50  Aligned_cols=12  Identities=58%  Similarity=0.911  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHHH
Q 000639           44 EMEKHERERRKE   55 (1378)
Q Consensus        44 E~Ek~erer~ke   55 (1378)
                      +.|+.-.+++.+
T Consensus        68 ~~E~E~~~~~~e   79 (201)
T PF12072_consen   68 ELERELKERRKE   79 (201)
T ss_pred             HHHHHHHHHHHH
Confidence            333333333333


No 62 
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=64.66  E-value=3.6  Score=53.46  Aligned_cols=39  Identities=23%  Similarity=0.165  Sum_probs=25.6

Q ss_pred             ccCCCcchhHhhhhcccccCCCHHHHHHHHHHHHHHHhc
Q 000639          578 DESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANE  616 (1378)
Q Consensus       578 Des~~GE~Wl~~L~~g~Y~~LsieeKL~iL~~Lv~~ll~  616 (1378)
                      ++.+.|-.-+.....|.|+-.+++.+..+|.++++-+--
T Consensus       654 ~~aydGiaIiL~~a~g~~~i~Dpei~~~AL~vIincVc~  692 (1516)
T KOG1832|consen  654 NRAYDGIAIILDAANGSNSIVDPEIIQPALNVIINCVCP  692 (1516)
T ss_pred             ccccCceEEEeecccccccccCHHHHHHHHhhhheeecC
Confidence            444466666677777777777777777777777665443


No 63 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=64.46  E-value=1.8e+02  Score=38.80  Aligned_cols=17  Identities=18%  Similarity=0.012  Sum_probs=9.8

Q ss_pred             hhhhhcccCCCCHHHHH
Q 000639          206 TFADVLGLWPFTLDEFV  222 (1378)
Q Consensus       206 sF~~~L~LsPFTLDDf~  222 (1378)
                      .+...|.|-+++.|+-.
T Consensus       691 ~~~~~ldl~G~~~~eA~  707 (771)
T TIGR01069       691 EASLTLDLRGQRSEEAL  707 (771)
T ss_pred             CCCceEECCCCCHHHHH
Confidence            45556666666665544


No 64 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=64.35  E-value=86  Score=38.27  Aligned_cols=58  Identities=24%  Similarity=0.252  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHhhhhhHHHHHHHHHH
Q 000639           83 KFLQKEYLRAEKRRLKEELRMEKQAAKR--KVAIEKATARKMAKESMDLIEDEQLELMDL  140 (1378)
Q Consensus        83 ke~~kE~er~Ek~r~kEE~rreKEe~k~--k~~~Ek~~~rr~are~a~l~edE~lEl~el  140 (1378)
                      +.-++..++.+|+.+..+.+.+-+-.|+  .+.+||+..|+....-+..+|..+.|+..+
T Consensus       316 ~a~qeakek~~KEAqareaklqaec~rQ~qlaLEEKaaLrkerd~L~keLeekkreleql  375 (442)
T PF06637_consen  316 QASQEAKEKAGKEAQAREAKLQAECARQTQLALEEKAALRKERDSLAKELEEKKRELEQL  375 (442)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3334445555665555555544444343  345566555544433333344444444433


No 65 
>PTZ00491 major vault protein; Provisional
Probab=63.91  E-value=2.4e+02  Score=38.01  Aligned_cols=20  Identities=30%  Similarity=0.441  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 000639           26 ELERQDNLRRKNEERMRKEM   45 (1378)
Q Consensus        26 E~Ekqe~~rrk~EEr~rkE~   45 (1378)
                      ++|+|...-+.+.|+.|++.
T Consensus       682 ~Lerqk~~d~~~aE~~r~~l  701 (850)
T PTZ00491        682 RLERQKMHDKAKAEEQRTKL  701 (850)
T ss_pred             hhHHHhhhhHHHHHHHHHHH
Confidence            34555555455555555443


No 66 
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=63.56  E-value=3.9  Score=53.19  Aligned_cols=29  Identities=14%  Similarity=0.140  Sum_probs=13.3

Q ss_pred             CCCcchhHhhhhcccccCCCHHHHHHHHHH
Q 000639          580 SKPGESWIQGLAEGDYSHLSVEERLNALVA  609 (1378)
Q Consensus       580 s~~GE~Wl~~L~~g~Y~~LsieeKL~iL~~  609 (1378)
                      ++-|---|..|.. +---+...+-|.+|.|
T Consensus       737 ~ndGIkiLl~Ll~-~k~P~t~aD~IRalAc  765 (1516)
T KOG1832|consen  737 GNDGIKILLKLLQ-YKNPPTTADCIRALAC  765 (1516)
T ss_pred             cCccHHHHHHHHh-ccCCCCcHHHHHHHHH
Confidence            4455555555555 2223333444444443


No 67 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=62.38  E-value=42  Score=42.94  Aligned_cols=21  Identities=29%  Similarity=0.545  Sum_probs=11.0

Q ss_pred             CCCccccccCCCCCCccccchhhhh
Q 000639          965 HCPSCHRTFGAVDKSSKFSEHSIQC  989 (1378)
Q Consensus       965 hc~~cH~tf~~~dl~~~fs~h~a~c  989 (1378)
                      .|..|.+.|-.    --+..|..+|
T Consensus       543 ~C~~Cgk~Vrl----rdm~~H~~~~  563 (567)
T PLN03086        543 PCDSCGRSVML----KEMDIHQIAV  563 (567)
T ss_pred             EccccCCeeee----hhHHHHHHHh
Confidence            46666666653    1244555555


No 68 
>TIGR01069 mutS2 MutS2 family protein. Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function.
Probab=62.19  E-value=2e+02  Score=38.40  Aligned_cols=11  Identities=18%  Similarity=-0.034  Sum_probs=6.2

Q ss_pred             cCCCCCHHHHH
Q 000639          293 LLNPLTWHEIF  303 (1378)
Q Consensus       293 ~LdslTWPEIL  303 (1378)
                      .|-.+|-.|-+
T Consensus       697 dl~G~~~~eA~  707 (771)
T TIGR01069       697 DLRGQRSEEAL  707 (771)
T ss_pred             ECCCCCHHHHH
Confidence            45556666555


No 69 
>PF05918 API5:  Apoptosis inhibitory protein 5 (API5);  InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterised by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in Homo sapiens chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors [,].; PDB: 3U0R_A 3V6A_A.
Probab=61.90  E-value=2.6  Score=53.09  Aligned_cols=14  Identities=36%  Similarity=0.453  Sum_probs=9.3

Q ss_pred             ecCHHHHHHHHHhc
Q 000639          808 IDTVEAFDALLSSL  821 (1378)
Q Consensus       808 y~t~eeLd~Ll~~L  821 (1378)
                      .+.++.||-||.|+
T Consensus       236 ~sD~e~Idrli~C~  249 (556)
T PF05918_consen  236 PSDPESIDRLISCL  249 (556)
T ss_dssp             SSSHHHHHHHHHHH
T ss_pred             CcCHHHHHHHHHHH
Confidence            45677777777754


No 70 
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=61.44  E-value=4.1e+02  Score=33.24  Aligned_cols=10  Identities=20%  Similarity=0.205  Sum_probs=6.0

Q ss_pred             HHhhhhhccc
Q 000639          204 FITFADVLGL  213 (1378)
Q Consensus       204 L~sF~~~L~L  213 (1378)
                      |+.||+..+=
T Consensus       308 l~rFG~~~~g  317 (420)
T COG4942         308 LRRFGQADGG  317 (420)
T ss_pred             HHHhcccCCC
Confidence            5667765543


No 71 
>PF09731 Mitofilin:  Mitochondrial inner membrane protein;  InterPro: IPR019133  Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=60.96  E-value=4.5e+02  Score=33.55  Aligned_cols=11  Identities=36%  Similarity=0.655  Sum_probs=5.6

Q ss_pred             CCCCccchhhh
Q 000639          331 EGKGCEDIVST  341 (1378)
Q Consensus       331 eg~~~edvi~~  341 (1378)
                      .|.|-+.||+.
T Consensus       519 ~~~d~~~ilar  529 (582)
T PF09731_consen  519 EGDDVESILAR  529 (582)
T ss_pred             CCCCHHHHHHH
Confidence            45555555544


No 72 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=60.58  E-value=2.8e+02  Score=37.11  Aligned_cols=16  Identities=19%  Similarity=0.156  Sum_probs=8.5

Q ss_pred             hhhhcccCCCCHHHHH
Q 000639          207 FADVLGLWPFTLDEFV  222 (1378)
Q Consensus       207 F~~~L~LsPFTLDDf~  222 (1378)
                      +...|.|-+++.|+-.
T Consensus       703 ~~~~lDL~G~~~eeA~  718 (782)
T PRK00409        703 VSLELDLRGMRYEEAL  718 (782)
T ss_pred             CCceEECCCCCHHHHH
Confidence            4445555666655433


No 73 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=59.39  E-value=6.6  Score=48.09  Aligned_cols=12  Identities=25%  Similarity=0.310  Sum_probs=7.4

Q ss_pred             cccCcCCCCCCc
Q 000639         1354 IDMSEASDQNGI 1365 (1378)
Q Consensus      1354 ~~m~~~~d~n~~ 1365 (1378)
                      .+.++.+|||--
T Consensus        92 ~~~~~~ddG~~T  103 (458)
T PF10446_consen   92 HDFDSDDDGNET  103 (458)
T ss_pred             ccccccccCccC
Confidence            445557888555


No 74 
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification]
Probab=58.25  E-value=2.6e+02  Score=36.53  Aligned_cols=53  Identities=15%  Similarity=0.155  Sum_probs=23.2

Q ss_pred             chhHhhhhcccccCCCHHHHHHHHHHHHHHHhcchh---HHHHHHHHHHH-HHHHHHHHHH
Q 000639          584 ESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNS---IRAVLEDRLEA-ANALKKQMWA  640 (1378)
Q Consensus       584 E~Wl~~L~~g~Y~~LsieeKL~iL~~Lv~~ll~sss---VR~~IderlEq-a~aLrkq~w~  640 (1378)
                      .||+.-.-.-+.+.=.    -.+.-|+|+.+...++   |-..|..-|++ +-...--||-
T Consensus       598 rpwV~KKIiEflGeeE----~tLVdFI~s~i~~h~~~q~iL~dl~~ilDEdAE~FV~KmWR  654 (668)
T KOG2253|consen  598 RPWVNKKIIEFLGEEE----DTLVDFICSNIRQHSSPQQILDDLAMILDEDAEVFVVKMWR  654 (668)
T ss_pred             HHHHHHHHHHHhCCcc----hhHHHHHHHHHHhcCCHHHHHHHHHHHHhcchHHHHHHHHH
Confidence            3666555444333211    1344555665555443   22333333333 3344445666


No 75 
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=57.99  E-value=5.7e+02  Score=34.00  Aligned_cols=11  Identities=0%  Similarity=0.045  Sum_probs=4.4

Q ss_pred             HHHHHHhhccC
Q 000639          219 DEFVQAFHDHE  229 (1378)
Q Consensus       219 DDf~qAL~~~d  229 (1378)
                      +.+...|...|
T Consensus       632 ei~~~~~~~~d  642 (697)
T PF09726_consen  632 EIAQGQLRKKD  642 (697)
T ss_pred             HHHHHHHHHHH
Confidence            33344444433


No 76 
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]
Probab=57.62  E-value=1.5e+02  Score=35.39  Aligned_cols=8  Identities=25%  Similarity=0.256  Sum_probs=3.0

Q ss_pred             HHHHHHHH
Q 000639          100 ELRMEKQA  107 (1378)
Q Consensus       100 E~rreKEe  107 (1378)
                      ++|++-++
T Consensus       384 ~~rr~Lee  391 (406)
T KOG3859|consen  384 EKRKQLEE  391 (406)
T ss_pred             HHHHHHHH
Confidence            33333333


No 77 
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=55.92  E-value=5.2e+02  Score=32.66  Aligned_cols=9  Identities=44%  Similarity=0.427  Sum_probs=5.7

Q ss_pred             CCcchhHHH
Q 000639          371 TPGTVKFAA  379 (1378)
Q Consensus       371 ~~gT~K~~~  379 (1378)
                      .|||-|+-+
T Consensus       392 PPGTGKTm~  400 (630)
T KOG0742|consen  392 PPGTGKTMF  400 (630)
T ss_pred             CCCCCchHH
Confidence            577777644


No 78 
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=55.89  E-value=6.1e+02  Score=33.46  Aligned_cols=9  Identities=33%  Similarity=0.479  Sum_probs=3.9

Q ss_pred             HHHHHHHHH
Q 000639          301 EIFRQLALS  309 (1378)
Q Consensus       301 EILRq~lls  309 (1378)
                      |+-|-|+.-
T Consensus       724 ELrrKHamq  732 (948)
T KOG0577|consen  724 ELRRKHAMQ  732 (948)
T ss_pred             HHHHHHHHH
Confidence            444444443


No 79 
>KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms]
Probab=52.29  E-value=4e+02  Score=30.22  Aligned_cols=20  Identities=40%  Similarity=0.428  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 000639           89 YLRAEKRRLKEELRMEKQAA  108 (1378)
Q Consensus        89 ~er~Ek~r~kEE~rreKEe~  108 (1378)
                      .|++||++++|+.|++|++.
T Consensus       198 kEkeekK~~KeaKrk~k~ek  217 (225)
T KOG4848|consen  198 KEKEEKKAVKEAKRKEKQEK  217 (225)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34455555565555555433


No 80 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=51.56  E-value=4.6e+02  Score=35.18  Aligned_cols=11  Identities=18%  Similarity=0.323  Sum_probs=5.7

Q ss_pred             cCCCCCHHHHH
Q 000639          293 LLNPLTWHEIF  303 (1378)
Q Consensus       293 ~LdslTWPEIL  303 (1378)
                      .|-.+|--|.+
T Consensus       708 DL~G~~~eeA~  718 (782)
T PRK00409        708 DLRGMRYEEAL  718 (782)
T ss_pred             ECCCCCHHHHH
Confidence            44455655553


No 81 
>PF15558 DUF4659:  Domain of unknown function (DUF4659)
Probab=50.21  E-value=5.9e+02  Score=31.57  Aligned_cols=9  Identities=22%  Similarity=0.257  Sum_probs=3.8

Q ss_pred             HHHHHHHhc
Q 000639          351 AFAWMREKG  359 (1378)
Q Consensus       351 ~~~~m~~~G  359 (1378)
                      .++.+++++
T Consensus       285 e~~~~kEk~  293 (376)
T PF15558_consen  285 ELNQEKEKN  293 (376)
T ss_pred             HHHHHHHHH
Confidence            334444443


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=49.67  E-value=4.9  Score=32.88  Aligned_cols=26  Identities=23%  Similarity=0.589  Sum_probs=20.0

Q ss_pred             cccchhhhccccccc---------CCCCccccccC
Q 000639          949 LVICDVCLDSYLCED---------AHCPSCHRTFG  974 (1378)
Q Consensus       949 l~~c~~c~~~y~~~e---------~hc~~cH~tf~  974 (1378)
                      ...|+.|...|.-.+         -.|+.||.+|.
T Consensus         2 ~~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         2 RIQCPNCKTSFRVVDSQLGANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EEECCCCCCEEEeCHHHcCCCCCEEECCCCCCEEE
Confidence            357999998776653         48999998875


No 83 
>KOG3634 consensus Troponin [Cytoskeleton]
Probab=49.04  E-value=1.4e+02  Score=35.91  Aligned_cols=6  Identities=33%  Similarity=0.722  Sum_probs=2.4

Q ss_pred             HHHHHH
Q 000639          235 EIHLAL  240 (1378)
Q Consensus       235 EIH~aL  240 (1378)
                      +||..|
T Consensus       241 ELhqrI  246 (361)
T KOG3634|consen  241 ELHQRI  246 (361)
T ss_pred             HHHHHH
Confidence            344333


No 84 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=48.93  E-value=38  Score=41.65  Aligned_cols=9  Identities=33%  Similarity=0.608  Sum_probs=5.5

Q ss_pred             hcCCCCCHH
Q 000639          292 QLLNPLTWH  300 (1378)
Q Consensus       292 ~~LdslTWP  300 (1378)
                      ..|++.+|+
T Consensus       408 ~ll~pv~~g  416 (506)
T KOG2507|consen  408 NLLDPVSGG  416 (506)
T ss_pred             cccCccchh
Confidence            456666665


No 85 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=48.28  E-value=5.1  Score=30.61  Aligned_cols=23  Identities=30%  Similarity=0.875  Sum_probs=18.8

Q ss_pred             CCCCccccccCCCCCCccccchhhhhh
Q 000639          964 AHCPSCHRTFGAVDKSSKFSEHSIQCE  990 (1378)
Q Consensus       964 ~hc~~cH~tf~~~dl~~~fs~h~a~c~  990 (1378)
                      ..|+.|.++|..    ..+..|...|.
T Consensus         3 ~~C~~CgR~F~~----~~l~~H~~~C~   25 (25)
T PF13913_consen    3 VPCPICGRKFNP----DRLEKHEKICK   25 (25)
T ss_pred             CcCCCCCCEECH----HHHHHHHHhcC
Confidence            469999999963    58889998884


No 86 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=46.09  E-value=14  Score=45.46  Aligned_cols=29  Identities=31%  Similarity=0.581  Sum_probs=24.1

Q ss_pred             hhhcccchhhhcccccccCCCCccccccC
Q 000639          946 RQLLVICDVCLDSYLCEDAHCPSCHRTFG  974 (1378)
Q Consensus       946 ~~~l~~c~~c~~~y~~~e~hc~~cH~tf~  974 (1378)
                      .+-+..|+.|+-++-.+..||++||.+..
T Consensus       218 ~~~l~~C~~Cd~l~~~~~a~CpRC~~~L~  246 (419)
T PRK15103        218 RQGLRSCSCCTAILPADQPVCPRCHTKGY  246 (419)
T ss_pred             ccCCCcCCCCCCCCCCCCCCCCCCCCcCc
Confidence            34577899999998888889999997763


No 87 
>PF12128 DUF3584:  Protein of unknown function (DUF3584);  InterPro: IPR021979  This family consist of uncharacterised bacterial proteins. 
Probab=45.12  E-value=1.1e+03  Score=33.43  Aligned_cols=31  Identities=19%  Similarity=0.176  Sum_probs=16.6

Q ss_pred             hhHHHH--HhhcccCCH--HHHHH--HHHHHHhhhcc
Q 000639         1038 RRKTWG--MKLNMSSSA--EEVLQ--LLTILESGIKR 1068 (1378)
Q Consensus      1038 ~Rk~W~--~~l~~ass~--~ellq--vL~~le~aIk~ 1068 (1378)
                      ..+.|+  ..|...||-  .-|+.  +++.|-.+|+.
T Consensus      1107 ~~~~~rn~~~L~~vsS~G~syLi~~~~~i~l~~~lr~ 1143 (1201)
T PF12128_consen 1107 NDKVIRNDRQLNNVSSHGTSYLILCMFFIALTRMLRG 1143 (1201)
T ss_pred             cccccccHHHHHhcCCchHHHHHHHHHHHHHHHHhcC
Confidence            567787  666666653  22222  23445555555


No 88 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=44.36  E-value=7.3  Score=32.29  Aligned_cols=25  Identities=28%  Similarity=0.905  Sum_probs=16.4

Q ss_pred             cccchhhhcccccccC---------CCCcccccc
Q 000639          949 LVICDVCLDSYLCEDA---------HCPSCHRTF  973 (1378)
Q Consensus       949 l~~c~~c~~~y~~~e~---------hc~~cH~tf  973 (1378)
                      ..+|+.|+-.|--.+.         +|+.|+.+|
T Consensus         2 ~i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    2 IITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            4567777777766554         577777665


No 89 
>KOG3634 consensus Troponin [Cytoskeleton]
Probab=43.81  E-value=1.8e+02  Score=35.05  Aligned_cols=8  Identities=0%  Similarity=-0.039  Sum_probs=3.2

Q ss_pred             HHHHHHHH
Q 000639          197 LLMVWRFF  204 (1378)
Q Consensus       197 LLmVweFL  204 (1378)
                      +-.+|.-|
T Consensus       239 iKELhqrI  246 (361)
T KOG3634|consen  239 IKELHQRI  246 (361)
T ss_pred             HHHHHHHH
Confidence            33344433


No 90 
>PF09731 Mitofilin:  Mitochondrial inner membrane protein;  InterPro: IPR019133  Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=43.21  E-value=8.2e+02  Score=31.26  Aligned_cols=17  Identities=24%  Similarity=0.327  Sum_probs=8.7

Q ss_pred             cHHHHHHHHHHHHHHhc
Q 000639          231 RLLGEIHLALLKSIIKD  247 (1378)
Q Consensus       231 ~LL~EIH~aLLk~ll~d  247 (1378)
                      -||+.+...|+..|+-.
T Consensus       494 g~~~~~~s~~~S~l~~~  510 (582)
T PF09731_consen  494 GLLGHLLSYLFSLLLFR  510 (582)
T ss_pred             CHHHHHHHHHHheeeee
Confidence            45555555555544443


No 91 
>PF07888 CALCOCO1:  Calcium binding and coiled-coil domain (CALCOCO1) like;  InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1 (Q61026 from SWISSPROT), and thus enhances transcriptional activation by a number of nuclear receptors. CoCoA has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region []. 
Probab=43.13  E-value=8.7e+02  Score=31.54  Aligned_cols=35  Identities=20%  Similarity=0.169  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhcc
Q 000639          111 KVAIEKATARKMAKESMDLIEDEQLELMDLAAASK  145 (1378)
Q Consensus       111 k~~~Ek~~~rr~are~a~l~edE~lEl~el~a~sk  145 (1378)
                      -++.||+....+..+.++-|.+=+..+-.++...|
T Consensus       428 v~qkEKEql~~EkQeL~~yi~~Le~r~~~~~~~~~  462 (546)
T PF07888_consen  428 VAQKEKEQLQEEKQELLEYIERLEQRLDKVADEKW  462 (546)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Confidence            34445444444444433333322223334444333


No 92 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.60  E-value=5.9e+02  Score=30.75  Aligned_cols=10  Identities=10%  Similarity=-0.041  Sum_probs=5.9

Q ss_pred             CCCCHHHHHH
Q 000639          214 WPFTLDEFVQ  223 (1378)
Q Consensus       214 sPFTLDDf~q  223 (1378)
                      .+|+++..+.
T Consensus       285 GGy~~~~~~~  294 (309)
T TIGR00570       285 GGYTSNLACE  294 (309)
T ss_pred             CCcCHHHHHH
Confidence            4677665544


No 93 
>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair]
Probab=42.55  E-value=10  Score=42.89  Aligned_cols=32  Identities=28%  Similarity=0.641  Sum_probs=26.7

Q ss_pred             hhhhhhcccchhhhcccccccCCCCccccccC
Q 000639          943 TRCRQLLVICDVCLDSYLCEDAHCPSCHRTFG  974 (1378)
Q Consensus       943 k~~~~~l~~c~~c~~~y~~~e~hc~~cH~tf~  974 (1378)
                      +|-+.+--+|.+|+-.+-+--.||+.||.-|.
T Consensus       254 ~rvv~~GfvCsVCLsvfc~p~~~C~~C~skF~  285 (296)
T COG5242         254 NRVVLLGFVCSVCLSVFCRPVPVCKKCKSKFS  285 (296)
T ss_pred             ccEEEEeeehhhhheeecCCcCcCcccccccc
Confidence            35556667899999999999999999997664


No 94 
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]
Probab=42.43  E-value=51  Score=40.65  Aligned_cols=12  Identities=25%  Similarity=0.747  Sum_probs=8.4

Q ss_pred             hhhhcCCCCCHH
Q 000639          289 NWQQLLNPLTWH  300 (1378)
Q Consensus       289 ~w~~~LdslTWP  300 (1378)
                      .|..+++++.||
T Consensus       423 ~~s~f~~~f~wp  434 (506)
T KOG2507|consen  423 RVSSFANPFSWP  434 (506)
T ss_pred             HHHHHhccCCCC
Confidence            455677777777


No 95 
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=42.15  E-value=16  Score=44.37  Aligned_cols=44  Identities=25%  Similarity=0.268  Sum_probs=20.0

Q ss_pred             CCCcccCCcccccccCCccchhhhcc-cccccCcccC-cCCCCCCc
Q 000639         1322 NRDVMEVSDEDEDAFGDDAGIEEAVD-EYSEGNIDMS-EASDQNGI 1365 (1378)
Q Consensus      1322 s~~~~e~sd~d~~~~~d~~~~e~~~~-~~~~~d~~m~-~~~d~n~~ 1365 (1378)
                      ++.+=+.|.|.+|+++|||+++++++ +|+.+|-|-. .|++-|-+
T Consensus       262 n~sv~~~ss~~edD~Dddd~dDdeeN~ddd~~d~d~e~~~v~dN~~  307 (514)
T KOG3130|consen  262 NCSVNGSSSYHEDDDDDDDDDDDEENIDDDDGDNDHEALGVGDNSI  307 (514)
T ss_pred             cccccCCCCccccccccccccchhhcccccccccchhhhccCCCcC
Confidence            33444444444444444443333333 4455554333 37766665


No 96 
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]
Probab=39.90  E-value=1.1e+03  Score=33.33  Aligned_cols=15  Identities=13%  Similarity=0.501  Sum_probs=11.0

Q ss_pred             chhhHHHHHHHHhcC
Q 000639          346 SAAENAFAWMREKGL  360 (1378)
Q Consensus       346 ~a~~~~~~~m~~~G~  360 (1378)
                      ..|.+.++-+++++|
T Consensus       652 e~aq~cI~fl~~~nL  666 (1293)
T KOG0996|consen  652 ETAQECINFLKKNNL  666 (1293)
T ss_pred             HHHHHHHHHHHHcCC
Confidence            445668888999883


No 97 
>PRK14474 F0F1 ATP synthase subunit B; Provisional
Probab=37.34  E-value=7.1e+02  Score=28.85  Aligned_cols=12  Identities=8%  Similarity=0.163  Sum_probs=6.9

Q ss_pred             CCCCChhhHHhH
Q 000639          186 PWSDSEENVGNL  197 (1378)
Q Consensus       186 p~~vp~e~vgdL  197 (1378)
                      +|++|++.-..+
T Consensus       183 a~~l~~~~~~~~  194 (250)
T PRK14474        183 SFELSQDLRAQI  194 (250)
T ss_pred             CCCCCHHHHHHH
Confidence            566677754333


No 98 
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=37.23  E-value=1.3e+03  Score=34.46  Aligned_cols=21  Identities=24%  Similarity=0.295  Sum_probs=10.0

Q ss_pred             hhhHHHHHHHhhccccccccC
Q 000639         1102 KTTAAVALRLLELDASIMYVK 1122 (1378)
Q Consensus      1102 ~TtsAvaLrl~~LDa~I~y~~ 1122 (1378)
                      .++++|=-||-.|-+.+.=..
T Consensus      1801 ~~i~~Learir~LE~~l~~E~ 1821 (1930)
T KOG0161|consen 1801 KQIAKLEARIRELESELEGEQ 1821 (1930)
T ss_pred             HHHHHHHHHHHHHHHHHhHhh
Confidence            344455555555554444333


No 99 
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=37.15  E-value=19  Score=43.77  Aligned_cols=42  Identities=26%  Similarity=0.678  Sum_probs=30.0

Q ss_pred             HHHHHhhhcccccchhhcchhhhhhhhcccchhhhccccc-ccCCCCccc
Q 000639          922 QWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLC-EDAHCPSCH  970 (1378)
Q Consensus       922 ~kWmw~~~~~~~~l~a~k~Gkk~~~~~l~~c~~c~~~y~~-~e~hc~~cH  970 (1378)
                      ..|+|...+- ..+.      -...+-+..|..||-+.-- ++-+|++||
T Consensus       200 ~~~lwe~~~p-q~~~------~~~~~~~~~C~~C~~~~~~~~~~~CpRC~  242 (418)
T COG2995         200 RRWLWERFYP-QTLA------TGAREGLRSCLCCHYILPHDAEPRCPRCG  242 (418)
T ss_pred             HHHHHHhhcc-ccCC------CCCcccceecccccccCCHhhCCCCCCCC
Confidence            4899997663 1111      3455667788999985544 899999999


No 100
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=36.13  E-value=22  Score=43.74  Aligned_cols=6  Identities=17%  Similarity=0.673  Sum_probs=3.1

Q ss_pred             hhhccc
Q 000639         1270 EEWGVG 1275 (1378)
Q Consensus      1270 e~W~~e 1275 (1378)
                      ++|-..
T Consensus        13 ddWi~~   18 (458)
T PF10446_consen   13 DDWIRQ   18 (458)
T ss_pred             hhhhhc
Confidence            556444


No 101
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=36.09  E-value=25  Score=43.08  Aligned_cols=27  Identities=22%  Similarity=0.613  Sum_probs=19.8

Q ss_pred             hcccchhhhccc-ccccCCCCccccccC
Q 000639          948 LLVICDVCLDSY-LCEDAHCPSCHRTFG  974 (1378)
Q Consensus       948 ~l~~c~~c~~~y-~~~e~hc~~cH~tf~  974 (1378)
                      -+..|+.|+-+. -....||++||.+..
T Consensus       214 ~~~~C~~Cd~~~~~~~~a~CpRC~~~L~  241 (403)
T TIGR00155       214 KLRSCSACHTTILPAQEPVCPRCSTPLY  241 (403)
T ss_pred             CCCcCCCCCCccCCCCCcCCcCCCCccc
Confidence            356699999843 355679999997763


No 102
>PRK04863 mukB cell division protein MukB; Provisional
Probab=35.98  E-value=1.6e+03  Score=32.64  Aligned_cols=9  Identities=11%  Similarity=0.113  Sum_probs=5.4

Q ss_pred             HHHHHHHHh
Q 000639          455 AAARKKIRI  463 (1378)
Q Consensus       455 ~~a~~~i~~  463 (1378)
                      .+|++.|..
T Consensus       719 ~~A~~ai~~  727 (1486)
T PRK04863        719 SDAAEQLAG  727 (1486)
T ss_pred             HHHHHHHHh
Confidence            456667763


No 103
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=35.74  E-value=23  Score=36.47  Aligned_cols=28  Identities=25%  Similarity=0.659  Sum_probs=24.7

Q ss_pred             chhhhcccccccCCCCccccccCC-CCCC
Q 000639          952 CDVCLDSYLCEDAHCPSCHRTFGA-VDKS  979 (1378)
Q Consensus       952 c~~c~~~y~~~e~hc~~cH~tf~~-~dl~  979 (1378)
                      |+.|.+....-.-+|+.|+++++. |.+.
T Consensus         1 CPvCg~~l~vt~l~C~~C~t~i~G~F~l~   29 (113)
T PF09862_consen    1 CPVCGGELVVTRLKCPSCGTEIEGEFELP   29 (113)
T ss_pred             CCCCCCceEEEEEEcCCCCCEEEeeeccc
Confidence            999999999999999999999984 5554


No 104
>PF14943 MRP-S26:  Mitochondrial ribosome subunit S26
Probab=35.50  E-value=6.5e+02  Score=27.87  Aligned_cols=23  Identities=26%  Similarity=0.245  Sum_probs=12.6

Q ss_pred             HHhhhhhHHHHHHHHHHHHhccC
Q 000639          124 KESMDLIEDEQLELMDLAAASKG  146 (1378)
Q Consensus       124 re~a~l~edE~lEl~el~a~sk~  146 (1378)
                      .++...|..|-|+-.=..+..||
T Consensus       134 e~sk~FIT~ENLd~~IeeALdnp  156 (170)
T PF14943_consen  134 EESKNFITRENLDAAIEEALDNP  156 (170)
T ss_pred             HHhcCcCCHHhHHHHHHHHHcCC
Confidence            44555677776665544444443


No 105
>PF06098 Radial_spoke_3:  Radial spoke protein 3;  InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=35.42  E-value=5.1e+02  Score=30.99  Aligned_cols=14  Identities=29%  Similarity=0.468  Sum_probs=7.9

Q ss_pred             ChhhhhccccccCC
Q 000639          154 DLETLQNLDSFRDS  167 (1378)
Q Consensus       154 d~etlqnlds~Rd~  167 (1378)
                      .+++|++...|.+.
T Consensus       228 v~~~L~~~G~f~dp  241 (291)
T PF06098_consen  228 VLDSLEDSGYFYDP  241 (291)
T ss_pred             HHHHHHHCCCCCCh
Confidence            34556666666554


No 106
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=34.32  E-value=6.5e+02  Score=27.46  Aligned_cols=16  Identities=31%  Similarity=0.285  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHHHHHHH
Q 000639          105 KQAAKRKVAIEKATAR  120 (1378)
Q Consensus       105 KEe~k~k~~~Ek~~~r  120 (1378)
                      ++.+++..+.|++.+.
T Consensus       102 ~~~A~~~Ie~Ek~~Al  117 (154)
T PRK06568        102 KSDAIQLIQNQKSTAS  117 (154)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3344444444444433


No 107
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=33.50  E-value=44  Score=44.58  Aligned_cols=8  Identities=0%  Similarity=0.061  Sum_probs=3.4

Q ss_pred             cccccCcc
Q 000639         1247 FQGQMGHM 1254 (1378)
Q Consensus      1247 llg~~~~~ 1254 (1378)
                      +|-.|++.
T Consensus       254 ~vrel~fd  261 (840)
T PF04147_consen  254 LVRELAFD  261 (840)
T ss_pred             HHHHhccc
Confidence            44444443


No 108
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=31.77  E-value=24  Score=47.68  Aligned_cols=9  Identities=22%  Similarity=0.519  Sum_probs=4.7

Q ss_pred             chhHHHHHH
Q 000639          617 GNSIRAVLE  625 (1378)
Q Consensus       617 sssVR~~Id  625 (1378)
                      +..+|.+|+
T Consensus       938 ad~~~QfLd  946 (3015)
T KOG0943|consen  938 ADACRQFLD  946 (3015)
T ss_pred             HHHHHHHHH
Confidence            344565554


No 109
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=31.61  E-value=17  Score=30.15  Aligned_cols=25  Identities=28%  Similarity=0.869  Sum_probs=16.8

Q ss_pred             cccchhhhcccccccC---------CCCcccccc
Q 000639          949 LVICDVCLDSYLCEDA---------HCPSCHRTF  973 (1378)
Q Consensus       949 l~~c~~c~~~y~~~e~---------hc~~cH~tf  973 (1378)
                      ..+|+.|+-.|--++.         .|+.|..+|
T Consensus         2 ~i~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    2 IITCPNCQAKYEIDDEKIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEEeCCHHHCCCCCcEEECCCCCCEe
Confidence            3567777777766654         677777665


No 110
>PF09736 Bud13:  Pre-mRNA-splicing factor of RES complex;  InterPro: IPR018609 Bud site selection protein 13, also known as pre-mRNA-splicing factor CWC26, belongs to the pre-mRNA retention and splicing (RES) complex. May also be involved in positioning the proximal bud pole signal [, , ]. The presence of RES subunit homologues in numerous eukaryotes suggests that its function is evolutionarily conserved [].
Probab=30.63  E-value=4.2e+02  Score=28.49  Aligned_cols=22  Identities=14%  Similarity=-0.058  Sum_probs=12.2

Q ss_pred             hhhHHHHHHHHHHHHhccCCcc
Q 000639          128 DLIEDEQLELMDLAAASKGLSS  149 (1378)
Q Consensus       128 ~l~edE~lEl~el~a~sk~l~S  149 (1378)
                      .-.+|++|+-+.-...-.+.|-
T Consensus        66 R~~dD~~~~~~lk~~~r~~DPm   87 (145)
T PF09736_consen   66 RYADDEDLNEELKEQERWDDPM   87 (145)
T ss_pred             chhhhHHHHHHHHhcccccCcH
Confidence            3467777775544444444444


No 111
>PF10147 CR6_interact:  Growth arrest and DNA-damage-inducible proteins-interacting protein 1;  InterPro: IPR018472 Members of this family of proteins act as negative regulators of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occur also in the absence of GADD45 proteins. Furthermore, they act as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity []. They may be involved in the hormone-mediated regulation of NR4A1 transcriptional activity.; GO: 0007049 cell cycle, 0005634 nucleus
Probab=30.61  E-value=8.9e+02  Score=27.96  Aligned_cols=8  Identities=50%  Similarity=0.455  Sum_probs=2.9

Q ss_pred             HHHHHHHH
Q 000639          109 KRKVAIEK  116 (1378)
Q Consensus       109 k~k~~~Ek  116 (1378)
                      |+++.+++
T Consensus       199 Kkk~k~ek  206 (217)
T PF10147_consen  199 KKKEKEEK  206 (217)
T ss_pred             HHHHHHHH
Confidence            33333333


No 112
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.54  E-value=1.1e+03  Score=28.76  Aligned_cols=9  Identities=22%  Similarity=0.158  Sum_probs=3.9

Q ss_pred             HHHHHHHHH
Q 000639          235 EIHLALLKS  243 (1378)
Q Consensus       235 EIH~aLLk~  243 (1378)
                      ..+.+|+-+
T Consensus       292 ~~~RaL~EA  300 (309)
T TIGR00570       292 ACERALQEA  300 (309)
T ss_pred             HHHHHHHHH
Confidence            344444433


No 113
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=29.56  E-value=26  Score=35.72  Aligned_cols=24  Identities=25%  Similarity=0.722  Sum_probs=13.2

Q ss_pred             cchhhhcccc---cccCCCCccccccC
Q 000639          951 ICDVCLDSYL---CEDAHCPSCHRTFG  974 (1378)
Q Consensus       951 ~c~~c~~~y~---~~e~hc~~cH~tf~  974 (1378)
                      +|+.|...|.   ++-.+||.|..+|.
T Consensus        11 ~Cp~CG~kFYDLnk~PivCP~CG~~~~   37 (108)
T PF09538_consen   11 TCPSCGAKFYDLNKDPIVCPKCGTEFP   37 (108)
T ss_pred             cCCCCcchhccCCCCCccCCCCCCccC
Confidence            4566655443   34555666666554


No 114
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=29.47  E-value=32  Score=43.39  Aligned_cols=9  Identities=33%  Similarity=0.213  Sum_probs=3.5

Q ss_pred             CCCCCcccc
Q 000639         1140 IPSRYLPLK 1148 (1378)
Q Consensus      1140 lpsr~~~~K 1148 (1378)
                      ++|-+.|+|
T Consensus        25 ~FS~vGPik   33 (678)
T KOG0127|consen   25 FFSYVGPIK   33 (678)
T ss_pred             hhhcccCcc
Confidence            333333333


No 115
>PRK02363 DNA-directed RNA polymerase subunit delta; Reviewed
Probab=28.86  E-value=62  Score=34.07  Aligned_cols=74  Identities=20%  Similarity=0.312  Sum_probs=53.2

Q ss_pred             HHHHHHhhcCCCCccHHHHHHHhhhhccccCCCCCCch---hhHHHhhccccchhhcccCcceeeccCcCCChhhHHHHH
Q 000639          378 AAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPE---ASISVALTRDTKLFERIAPSTYCVRPAFRKDPADAEAIL  454 (1378)
Q Consensus       378 ~~f~vls~~G~~gl~v~e~a~~~q~~~l~~~~t~~~~e---~~i~~~ls~D~~Lferiapsty~lr~~~r~dp~~~e~~~  454 (1378)
                      .||.+|... .+-|+..+|...||+....   +-+...   +-+|.-|.-|. -|..+--++|+||.-|-.|.-+ +.|.
T Consensus         8 vAy~iL~~~-~~~m~f~dL~~ev~~~~~~---s~e~~~~~iaq~YtdLn~DG-RFi~lG~n~WgLr~w~p~d~i~-e~~~   81 (129)
T PRK02363          8 VAYEILKEK-KEPMSFYDLVNEIQKYLGK---SDEEIRERIAQFYTDLNLDG-RFISLGDNKWGLRSWYPVDEID-EEII   81 (129)
T ss_pred             HHHHHHHHc-CCcccHHHHHHHHHHHhCC---CHHHHHHHHHHHHHHHhccC-CeeEcCCCceecccccChhhhh-hhhh
Confidence            588999887 6789999999999887542   111222   33466777888 7999999999999977776633 4444


Q ss_pred             HHH
Q 000639          455 AAA  457 (1378)
Q Consensus       455 ~~a  457 (1378)
                      ...
T Consensus        82 ~~~   84 (129)
T PRK02363         82 PLE   84 (129)
T ss_pred             cch
Confidence            443


No 116
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=28.82  E-value=1.6e+03  Score=32.30  Aligned_cols=30  Identities=27%  Similarity=0.369  Sum_probs=21.8

Q ss_pred             hhhhhhcccchhhhhhcCCCCCHHHHHHHHHHH
Q 000639          277 IEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALS  309 (1378)
Q Consensus       277 v~~a~~WGf~l~~w~~~LdslTWPEILRq~lls  309 (1378)
                      ...+|.|   -..|+.++..++|..|++....-
T Consensus       489 ~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  518 (1353)
T TIGR02680       489 EGARLAW---VDAWQAQLRELTILAVDDQPGAL  518 (1353)
T ss_pred             HHHHHHH---hhhHHhhhccchhhhhcchhhhh
Confidence            3445556   56788999999999987766553


No 117
>smart00017 OSTEO Osteopontin. Osteopontin is an acidic phosphorylated glycoprotein of about 40 Kd which is abundant in the mineral matrix of bones and which binds tightly to hydroxyapatite [1,2,3]. It is suggested that osteopontin might function as a cell attachment factor and could play a key role in the adhesion of osteoclasts to the mineral matrix of bone
Probab=28.64  E-value=49  Score=38.02  Aligned_cols=31  Identities=19%  Similarity=0.276  Sum_probs=20.0

Q ss_pred             cccccccccCCcccccccCCccccccCCCCCCCCCCcccCCc
Q 000639         1289 NSAEAVDSDDNVQAVEYEQGNWEVGFNGATNGWNRDVMEVSD 1330 (1378)
Q Consensus      1289 ~~~e~e~~ddn~q~~eYd~~~~~~gfng~~~~~s~~~~e~sd 1330 (1378)
                      |+..+|+-||+-|++          |-+++|- |-+-|++-|
T Consensus        43 n~vSSEEtdD~kQet----------lPsksne-Shd~~DD~d   73 (287)
T smart00017       43 NAVSSEETDDFKQET----------LPSKSNE-SHEHTDDLD   73 (287)
T ss_pred             ccccccccccccccc----------CCCCCcc-Chhhccccc
Confidence            334445667778888          8888887 555555433


No 118
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=28.04  E-value=1.6e+03  Score=32.35  Aligned_cols=28  Identities=29%  Similarity=0.097  Sum_probs=12.7

Q ss_pred             eeccCcCCChhhHHHHHHHHHHHHHhhccCCCCC
Q 000639          438 CVRPAFRKDPADAEAILAAARKKIRIFENGFLGG  471 (1378)
Q Consensus       438 ~lr~~~r~dp~~~e~~~~~a~~~i~~f~~~~~~~  471 (1378)
                      .+...-..+|... +-|.||     +...|++|.
T Consensus       607 l~df~e~v~~~~r-a~IEaA-----L~~~GLLDA  634 (1353)
T TIGR02680       607 LVDFADDVPADVR-AGLEAA-----LEAAGLLDA  634 (1353)
T ss_pred             heecCCCCCHHHH-HHHHHH-----HHHCCCcce
Confidence            3333344555443 334443     334566664


No 119
>PF06098 Radial_spoke_3:  Radial spoke protein 3;  InterPro: IPR009290 This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organised, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibres, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation [].
Probab=27.92  E-value=4.7e+02  Score=31.30  Aligned_cols=10  Identities=40%  Similarity=0.564  Sum_probs=4.3

Q ss_pred             HHHHHHHHHH
Q 000639          116 KATARKMAKE  125 (1378)
Q Consensus       116 k~~~rr~are  125 (1378)
                      |-.++..|+.
T Consensus       210 Ki~Ar~~a~~  219 (291)
T PF06098_consen  210 KIAARAFAQQ  219 (291)
T ss_pred             HHHHHHHHHH
Confidence            3344444443


No 120
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription]
Probab=27.74  E-value=49  Score=43.37  Aligned_cols=82  Identities=24%  Similarity=0.356  Sum_probs=0.0

Q ss_pred             hhcccccc--cccccccccccccccccccCCcccccccCC-ccccccCCCCCCCCCC---cccCCccccc---ccCCccc
Q 000639         1271 EWGVGKER--MINMEDAENSNSAEAVDSDDNVQAVEYEQG-NWEVGFNGATNGWNRD---VMEVSDEDED---AFGDDAG 1341 (1378)
Q Consensus      1271 ~W~~e~~~--~~~~~~~eNs~~~e~e~~ddn~q~~eYd~~-~~~~gfng~~~~~s~~---~~e~sd~d~~---~~~d~~~ 1341 (1378)
                      +.|.+.+.  ...|-.++..+..|.+++|      +|+.| -=.+|+-+-    +.|   ++++.+|++|   .++|++.
T Consensus       859 e~~~e~~~k~~~d~~~D~d~~~deddd~d------~~s~~~~e~~~~Ed~----dEdi~~~~D~~~D~~d~~d~~e~e~d  928 (988)
T KOG2038|consen  859 EFGAEKDDKNKKDMTSDDDVDADEDDDED------ENSLGSEEDGGEEDD----DEDIGDSDDDEDDTSDAEDDFEDEDD  928 (988)
T ss_pred             hcCchhhchhhhccccccccccccccccc------hhcccCccccccccc----chhccccccccccchhhccccccccc


Q ss_pred             hhhhcccccccCcccCcCCCC
Q 000639         1342 IEEAVDEYSEGNIDMSEASDQ 1362 (1378)
Q Consensus      1342 ~e~~~~~~~~~d~~m~~~~d~ 1362 (1378)
                      .+.+.+++.+|-.+..|++++
T Consensus       929 ~~~~~e~~~~~g~d~~d~~~~  949 (988)
T KOG2038|consen  929 DEVDDEDGGEGGKDDADISGD  949 (988)
T ss_pred             cccccccccccCccccccccc


No 121
>KOG4691 consensus Uncharacterized conserved protein [Function unknown]
Probab=27.62  E-value=9.6e+02  Score=27.39  Aligned_cols=26  Identities=27%  Similarity=0.157  Sum_probs=19.2

Q ss_pred             HHhhhhhHHHHHHHHHHHHhccCCcc
Q 000639          124 KESMDLIEDEQLELMDLAAASKGLSS  149 (1378)
Q Consensus       124 re~a~l~edE~lEl~el~a~sk~l~S  149 (1378)
                      .++...|..|-||.+=+.+..+|..-
T Consensus       169 ersknfITReNLea~Ie~AL~~p~~y  194 (227)
T KOG4691|consen  169 ERSKNFITRENLEARIEAALDSPKNY  194 (227)
T ss_pred             HHHhhhhhHHhHHHHHHHHHcCcccc
Confidence            34677899999998888877766543


No 122
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=27.30  E-value=40  Score=44.48  Aligned_cols=9  Identities=11%  Similarity=0.464  Sum_probs=3.8

Q ss_pred             hhhhhhhhh
Q 000639         1029 ALEASWTDE 1037 (1378)
Q Consensus      1029 AL~~~W~~~ 1037 (1378)
                      .++..|...
T Consensus       507 ~~~~~~~~~  515 (784)
T PF04931_consen  507 EQQQAWKTL  515 (784)
T ss_pred             HHHHHHHHH
Confidence            444444433


No 123
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=27.20  E-value=1.4e+02  Score=33.61  Aligned_cols=49  Identities=29%  Similarity=0.316  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000639           45 MEKHERERRKEEERLMR-ERQREEERSLREQKREMERREKFLQKEYLRAE   93 (1378)
Q Consensus        45 ~Ek~erer~keeEr~er-e~~~EEER~~rE~~rEeeR~eke~~kE~er~E   93 (1378)
                      .|+.++.|+..||-++| ++.+++||..+..-.|++.++|+.+--.++.+
T Consensus       125 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  174 (197)
T PRK12585        125 QEQIEKARQEREELEERMEWERREEKIDEREDQEEQEREREEQTIEEQSD  174 (197)
T ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHhhHHhhcc


No 124
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton]
Probab=27.01  E-value=4.6e+02  Score=33.93  Aligned_cols=12  Identities=42%  Similarity=0.443  Sum_probs=5.8

Q ss_pred             hHHHhhccccch
Q 000639          417 SISVALTRDTKL  428 (1378)
Q Consensus       417 ~i~~~ls~D~~L  428 (1378)
                      +|.+-.|+|..|
T Consensus       591 ~i~V~rasdP~L  602 (645)
T KOG0681|consen  591 SINVVRASDPVL  602 (645)
T ss_pred             ceEEEecCCcch
Confidence            344455555533


No 125
>PRK04863 mukB cell division protein MukB; Provisional
Probab=26.19  E-value=2.3e+03  Score=31.28  Aligned_cols=21  Identities=14%  Similarity=0.021  Sum_probs=9.3

Q ss_pred             HHHHHHhcCChhhhhhhhhhh
Q 000639         1017 LSAVIEAYIPPEALEASWTDE 1037 (1378)
Q Consensus      1017 ~L~~iEa~ip~eAL~~~W~~~ 1037 (1378)
                      .|-.-|-+=-+|....||..-
T Consensus      1171 ~~~~~~~~~~~e~~~~~~~~~ 1191 (1486)
T PRK04863       1171 VLRLSEDPKRPERKVQFYIAV 1191 (1486)
T ss_pred             HHhhccCCCchhHHHhHHHHH
Confidence            333334333444445555544


No 126
>KOG2229 consensus Protein required for actin cytoskeleton organization and cell cycle progression [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=26.09  E-value=71  Score=40.36  Aligned_cols=104  Identities=16%  Similarity=0.119  Sum_probs=70.4

Q ss_pred             hcCCCCCHHHHHHHHHHHhCCCCccccccccccCCCCCCCCCCccchhhhhcccchhhHHHHHHHHhcCCCCccCCCccC
Q 000639          292 QLLNPLTWHEIFRQLALSAGFGPKLKKRSSKWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLT  371 (1378)
Q Consensus       292 ~~LdslTWPEILRq~llsaG~g~~~~~~~~~~~~~~~~~eg~~~edvi~~~r~g~a~~~~~~~m~~~G~~~~rr~~~rl~  371 (1378)
                      +.=|.++=.++|-.|+-.--+|+...+.-   .|          ..||.+|||-       +.|-+--          =.
T Consensus        48 rNk~~i~~~~LL~lff~l~~~~dk~lRkl---ly----------thiv~~Ikn~-------n~~~kn~----------kl   97 (616)
T KOG2229|consen   48 RNKNLIVAEDLLELFFPLLRCGDKNLRKL---LY----------THIVTTIKNI-------NKKHKND----------KL   97 (616)
T ss_pred             hccCcCCHHHHHHHHHHHHhcCchhHHHH---HH----------HHHHHHHHHH-------Hhhcccc----------hH
Confidence            34567787888888888877777764332   22          4678887753       2222211          11


Q ss_pred             CcchhHHHHHHHhhcCC-CCccHHHHHHHhhhhccccCCCCCCchhhHHHhhccccc
Q 000639          372 PGTVKFAAFHVLSLEGS-KGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTK  427 (1378)
Q Consensus       372 ~gT~K~~~f~vls~~G~-~gl~v~e~a~~~q~~~l~~~~t~~~~e~~i~~~ls~D~~  427 (1378)
                      .-.+-...|.+|.-.++ .|.--..+...+-+-+  .|.-++|.+-.+++|||++++
T Consensus        98 nkslq~~~fsml~~~d~~~ak~a~~~~~eL~kr~--iW~d~~tV~i~~~acf~~~~k  152 (616)
T KOG2229|consen   98 NKSLQAFMFSMLDQSDSTAAKMALDTMIELYKRN--IWNDSKTVNIITTACFSKVPK  152 (616)
T ss_pred             HHHHHHHHHHHHhCCCchhHHHHHHHHHHHHHhc--ccccchhHHHHHHHHhccCcH
Confidence            24567889999998887 5555555555555554  466999999999999999985


No 127
>PF12128 DUF3584:  Protein of unknown function (DUF3584);  InterPro: IPR021979  This family consist of uncharacterised bacterial proteins. 
Probab=25.47  E-value=2.1e+03  Score=30.62  Aligned_cols=31  Identities=13%  Similarity=-0.047  Sum_probs=16.8

Q ss_pred             hhhhcccccCCCHHHHHHHHHHHHHHHhcch
Q 000639          588 QGLAEGDYSHLSVEERLNALVALIGIANEGN  618 (1378)
Q Consensus       588 ~~L~~g~Y~~LsieeKL~iL~~Lv~~ll~ss  618 (1378)
                      .-|.+..=..++.=.++.++..|++.+-...
T Consensus      1115 ~~L~~vsS~G~syLi~~~~~i~l~~~lr~~~ 1145 (1201)
T PF12128_consen 1115 RQLNNVSSHGTSYLILCMFFIALTRMLRGDA 1145 (1201)
T ss_pred             HHHHhcCCchHHHHHHHHHHHHHHHHhcCCC
Confidence            3344444444555566677777766554433


No 128
>PLN02372 violaxanthin de-epoxidase
Probab=24.91  E-value=1e+03  Score=30.04  Aligned_cols=17  Identities=41%  Similarity=0.606  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 000639           10 ARIAREVEANEIRIQKE   26 (1378)
Q Consensus        10 ~r~~re~e~~e~r~rkE   26 (1378)
                      +|+++..+.-|+-+-||
T Consensus       364 ~~l~~~~e~~e~~i~~e  380 (455)
T PLN02372        364 ERLEKDVEEGEKTIVKE  380 (455)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34444444444444444


No 129
>PLN02316 synthase/transferase
Probab=24.85  E-value=2.1e+02  Score=39.40  Aligned_cols=23  Identities=22%  Similarity=0.209  Sum_probs=16.0

Q ss_pred             hhcCCCCccHHHHHHHhhhhccc
Q 000639          384 SLEGSKGLTVLELADKIQKSGLR  406 (1378)
Q Consensus       384 s~~G~~gl~v~e~a~~~q~~~l~  406 (1378)
                      +..|-=|-=|..|++.+++.|..
T Consensus       601 aKvGGLgDVV~sLp~ALa~~Gh~  623 (1036)
T PLN02316        601 AKVGGLGDVVTSLSRAVQDLNHN  623 (1036)
T ss_pred             CCcCcHHHHHHHHHHHHHHcCCE
Confidence            34455555678899998888853


No 130
>PF05918 API5:  Apoptosis inhibitory protein 5 (API5);  InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterised by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in Homo sapiens chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors [,].; PDB: 3U0R_A 3V6A_A.
Probab=24.45  E-value=25  Score=44.74  Aligned_cols=10  Identities=20%  Similarity=0.421  Sum_probs=2.2

Q ss_pred             ccCCCCchhh
Q 000639         1095 PILPWIPKTT 1104 (1378)
Q Consensus      1095 ~~lpw~p~Tt 1104 (1378)
                      ..|.|.+.+-
T Consensus       457 itlSWk~~~~  466 (556)
T PF05918_consen  457 ITLSWKEAKK  466 (556)
T ss_dssp             ---TTS----
T ss_pred             cceeeeeccc
Confidence            4467777665


No 131
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=24.27  E-value=9.5e+02  Score=26.20  Aligned_cols=8  Identities=13%  Similarity=0.434  Sum_probs=3.2

Q ss_pred             HHHHHHHH
Q 000639           21 IRIQKELE   28 (1378)
Q Consensus        21 ~r~rkE~E   28 (1378)
                      .+++.+++
T Consensus        38 ~~I~~~Ld   45 (154)
T PRK06568         38 LEVQEKVL   45 (154)
T ss_pred             HHHHHHHH
Confidence            33444443


No 132
>PF14943 MRP-S26:  Mitochondrial ribosome subunit S26
Probab=24.22  E-value=1e+03  Score=26.45  Aligned_cols=30  Identities=27%  Similarity=0.236  Sum_probs=17.4

Q ss_pred             HHHHHHHhccCCccccccChhhhhcccccc
Q 000639          136 ELMDLAAASKGLSSIIHLDLETLQNLDSFR  165 (1378)
Q Consensus       136 El~el~a~sk~l~S~~~Ld~etlqnlds~R  165 (1378)
                      +...+...|+.++-..+||.-=...|+++.
T Consensus       128 ~V~~~~e~sk~FIT~ENLd~~IeeALdnp~  157 (170)
T PF14943_consen  128 EVRQLKEESKNFITRENLDAAIEEALDNPV  157 (170)
T ss_pred             HHHHHHHHhcCcCCHHhHHHHHHHHHcCCc
Confidence            445566677777777766544444444443


No 133
>PF06409 NPIP:  Nuclear pore complex interacting protein (NPIP);  InterPro: IPR009443 This family consists of a series of primate specific nuclear pore complex interacting protein (NPIP) sequences. The function of this family is unknown but is well conserved from African apes to humans [].
Probab=23.82  E-value=1.1e+03  Score=27.55  Aligned_cols=26  Identities=27%  Similarity=0.129  Sum_probs=18.5

Q ss_pred             HhccCCccccccChhhhhccccccCC
Q 000639          142 AASKGLSSIIHLDLETLQNLDSFRDS  167 (1378)
Q Consensus       142 a~sk~l~S~~~Ld~etlqnlds~Rd~  167 (1378)
                      .-+.|++...-|..++|++.=-|+++
T Consensus       202 ~hssgl~~spyL~A~~l~~~M~~~pp  227 (265)
T PF06409_consen  202 HHSSGLPYSPYLMAEALQREMGHQPP  227 (265)
T ss_pred             ccCCCCcCchHHhHHHHHHhhCCCCc
Confidence            34568888888888888775555444


No 134
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=23.78  E-value=39  Score=35.57  Aligned_cols=6  Identities=33%  Similarity=0.601  Sum_probs=2.3

Q ss_pred             CcccCc
Q 000639         1353 NIDMSE 1358 (1378)
Q Consensus      1353 d~~m~~ 1358 (1378)
                      |.+|++
T Consensus       117 DdDv~D  122 (129)
T TIGR02300       117 DIDDED  122 (129)
T ss_pred             cccccc
Confidence            333443


No 135
>PRK11637 AmiB activator; Provisional
Probab=22.78  E-value=1.5e+03  Score=27.94  Aligned_cols=6  Identities=50%  Similarity=1.437  Sum_probs=2.2

Q ss_pred             CCCCCH
Q 000639          294 LNPLTW  299 (1378)
Q Consensus       294 LdslTW  299 (1378)
                      +||+.|
T Consensus       420 vnP~~~  425 (428)
T PRK11637        420 VNPQPW  425 (428)
T ss_pred             eChHHH
Confidence            333333


No 136
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=22.33  E-value=1.2e+03  Score=26.70  Aligned_cols=90  Identities=19%  Similarity=0.209  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000639           25 KELERQDNLRRKNEERMRKEMEKHERERRKEEERLMRERQREEERSLREQKREMERREKFLQKEYLRAEKRRLKEELRME  104 (1378)
Q Consensus        25 kE~Ekqe~~rrk~EEr~rkE~Ek~erer~keeEr~ere~~~EEER~~rE~~rEeeR~eke~~kE~er~Ek~r~kEE~rre  104 (1378)
                      .++++.=...-..-++.+++.++...+.+..-+.-..+.+.--+.-+++.+++.++.-.+.+.+.++..... +.+.+.+
T Consensus        35 ~~R~~~I~~~l~~Ae~~~~eA~~~~~e~e~~l~~a~~ea~~i~~~A~~eA~~~~~~i~~~A~~ea~~~~~~a-~~~ie~E  113 (246)
T TIGR03321        35 DAREKKIAGELADADTKKREAEQERREYEEKNEELDQQREVLLTKAKEEAQAERQRLLDEAREEADEIREKW-QEALRRE  113 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHH


Q ss_pred             HHHHHHHHHHH
Q 000639          105 KQAAKRKVAIE  115 (1378)
Q Consensus       105 KEe~k~k~~~E  115 (1378)
                      ++.+....+.+
T Consensus       114 ~~~a~~~l~~e  124 (246)
T TIGR03321       114 QAALSDELRRR  124 (246)
T ss_pred             HHHHHHHHHHH


No 137
>COG3909 Cytochrome c556 [Energy production and conversion]
Probab=21.30  E-value=19  Score=38.20  Aligned_cols=11  Identities=36%  Similarity=0.552  Sum_probs=8.0

Q ss_pred             HHHHHhHHHHH
Q 000639          912 KAALERFQDFQ  922 (1378)
Q Consensus       912 ~~~~~R~q~f~  922 (1378)
                      -..|.+.++|.
T Consensus        91 p~IWe~~~~FK  101 (147)
T COG3909          91 PAIWEDMADFK  101 (147)
T ss_pred             HHHHHhHHHHH
Confidence            35788888886


No 138
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]
Probab=20.73  E-value=3.1e+03  Score=30.89  Aligned_cols=14  Identities=21%  Similarity=0.057  Sum_probs=6.7

Q ss_pred             hHHHHHHHHHHHHH
Q 000639         1009 LGIRLLKPLSAVIE 1022 (1378)
Q Consensus      1009 ~~ir~LK~~L~~iE 1022 (1378)
                      ..|+.+|.+|..-|
T Consensus      1864 ~k~~~~krQleeaE 1877 (1930)
T KOG0161|consen 1864 AKIKQYKRQLEEAE 1877 (1930)
T ss_pred             HHHHHHHHhHHHHH
Confidence            34455555554443


No 139
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=20.54  E-value=65  Score=35.43  Aligned_cols=30  Identities=20%  Similarity=0.647  Sum_probs=19.1

Q ss_pred             hcccchhhhcccccc-----cCCCCccccccCCCC
Q 000639          948 LLVICDVCLDSYLCE-----DAHCPSCHRTFGAVD  977 (1378)
Q Consensus       948 ~l~~c~~c~~~y~~~-----e~hc~~cH~tf~~~d  977 (1378)
                      ++-+|+.|+-.|-.+     +-+||.|..+..-+|
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~~~F~Cp~Cg~~L~~~d  150 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAMEYGFRCPQCGEMLEEYD  150 (178)
T ss_pred             CEEECCCCCcEEeHHHHhhcCCcCCCCCCCCeecc
Confidence            455566666666443     568888886666544


No 140
>KOG4722 consensus Zn-finger protein [General function prediction only]
Probab=20.37  E-value=1.8e+03  Score=27.95  Aligned_cols=13  Identities=8%  Similarity=0.227  Sum_probs=6.6

Q ss_pred             cccccCCCCCCCC
Q 000639          161 LDSFRDSLSVFPP  173 (1378)
Q Consensus       161 lds~Rd~Lp~FPp  173 (1378)
                      -..+.+.|.||-.
T Consensus       480 ntdyapkltpyer  492 (672)
T KOG4722|consen  480 NTDYAPKLTPYER  492 (672)
T ss_pred             ccccccccChHHh
Confidence            4445555555543


No 141
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=20.07  E-value=34  Score=28.05  Aligned_cols=25  Identities=28%  Similarity=0.489  Sum_probs=17.1

Q ss_pred             hhhcccchhhhcccccccCCCCccc
Q 000639          946 RQLLVICDVCLDSYLCEDAHCPSCH  970 (1378)
Q Consensus       946 ~~~l~~c~~c~~~y~~~e~hc~~cH  970 (1378)
                      .=++.+|..|..++|.--..|+.||
T Consensus         8 ~l~~~rC~~Cg~~~~pPr~~Cp~C~   32 (37)
T PF12172_consen    8 RLLGQRCRDCGRVQFPPRPVCPHCG   32 (37)
T ss_dssp             -EEEEE-TTT--EEES--SEETTTT
T ss_pred             EEEEEEcCCCCCEecCCCcCCCCcC
Confidence            3457899999999999999999999


Done!