BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000643
         (1377 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ECT|A Chain A, Crystal Structure Of The Hexapeptide-repeat Containing-
           Acetyltransferase Vca0836 From Vibrio Cholerae
 pdb|3NZ2|A Chain A, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|B Chain B, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|C Chain C, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|D Chain D, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|E Chain E, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|F Chain F, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|G Chain G, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|H Chain H, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|I Chain I, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|J Chain J, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|K Chain K, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
 pdb|3NZ2|L Chain L, Crystal Structure Of Hexapeptide-Repeat
           Containing-Acetyltransferase Vca0836 Complexed With
           Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
          Length = 195

 Score = 30.0 bits (66), Expect = 9.0,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 188 EAFDGLSLEIEQSRSRLQELEHKLQCSVDEARKF 221
           E FDG S EIE  RS+   L+ ++  S+DEA ++
Sbjct: 16  EHFDGASAEIEALRSQAGRLKLEINQSLDEAERY 49


>pdb|3LHP|S Chain S, Crystal Structure Of Hiv Epitope-Scaffold
            4e10_d0_1isea_004_n 4e10 Fv Complex
 pdb|3LHP|T Chain T, Crystal Structure Of Hiv Epitope-Scaffold
            4e10_d0_1isea_004_n 4e10 Fv Complex
          Length = 123

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 1151 ETFKSEIESLKAQAAEKFALETRIKELEELLVNVETQFKEEVENV------KVSAAGKEA 1204
            E FK++++  KA   + F  E RIK+  +++     Q +  V NV      K +A GK+ 
Sbjct: 25   EAFKNKLDKFKAAVRKVFPTEERIKDWLKIVRGEAEQARVAVRNVGRDANDKAAALGKDK 84

Query: 1205 ELN 1207
            E+N
Sbjct: 85   EIN 87


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.303    0.120    0.295 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,938,519
Number of Sequences: 62578
Number of extensions: 941568
Number of successful extensions: 4056
Number of sequences better than 100.0: 146
Number of HSP's better than 100.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 100
Number of HSP's that attempted gapping in prelim test: 3335
Number of HSP's gapped (non-prelim): 626
length of query: 1377
length of database: 14,973,337
effective HSP length: 111
effective length of query: 1266
effective length of database: 8,027,179
effective search space: 10162408614
effective search space used: 10162408614
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 58 (26.9 bits)