BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 000644
(1377 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ECT|A Chain A, Crystal Structure Of The Hexapeptide-repeat Containing-
Acetyltransferase Vca0836 From Vibrio Cholerae
pdb|3NZ2|A Chain A, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|B Chain B, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|C Chain C, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|D Chain D, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|E Chain E, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|F Chain F, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|G Chain G, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|H Chain H, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|I Chain I, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|J Chain J, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|K Chain K, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
pdb|3NZ2|L Chain L, Crystal Structure Of Hexapeptide-Repeat
Containing-Acetyltransferase Vca0836 Complexed With
Acetyl Co Enzyme A From Vibrio Cholerae O1 Biovar Eltor
Length = 195
Score = 30.0 bits (66), Expect = 9.0, Method: Composition-based stats.
Identities = 15/34 (44%), Positives = 22/34 (64%)
Query: 188 EAFDGLSLEIEQSRSRLQELEHKLQCSVDEARKF 221
E FDG S EIE RS+ L+ ++ S+DEA ++
Sbjct: 16 EHFDGASAEIEALRSQAGRLKLEINQSLDEAERY 49
>pdb|3LHP|S Chain S, Crystal Structure Of Hiv Epitope-Scaffold
4e10_d0_1isea_004_n 4e10 Fv Complex
pdb|3LHP|T Chain T, Crystal Structure Of Hiv Epitope-Scaffold
4e10_d0_1isea_004_n 4e10 Fv Complex
Length = 123
Score = 30.0 bits (66), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 6/63 (9%)
Query: 1151 ETFKSEIESLKAQAAEKFALETRIKELEELLVNVETQFKEEVENV------KVSAAGKEA 1204
E FK++++ KA + F E RIK+ +++ Q + V NV K +A GK+
Sbjct: 25 EAFKNKLDKFKAAVRKVFPTEERIKDWLKIVRGEAEQARVAVRNVGRDANDKAAALGKDK 84
Query: 1205 ELN 1207
E+N
Sbjct: 85 EIN 87
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.303 0.120 0.295
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,938,519
Number of Sequences: 62578
Number of extensions: 941568
Number of successful extensions: 4056
Number of sequences better than 100.0: 146
Number of HSP's better than 100.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 100
Number of HSP's that attempted gapping in prelim test: 3335
Number of HSP's gapped (non-prelim): 626
length of query: 1377
length of database: 14,973,337
effective HSP length: 111
effective length of query: 1266
effective length of database: 8,027,179
effective search space: 10162408614
effective search space used: 10162408614
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 58 (26.9 bits)