BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000652
         (1372 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QDS|A Chain A, Superstable E65q Mutant Of Leishmania Mexicana
           Triosephosphate Isomerase (Tim)
 pdb|1IF2|A Chain A, X-Ray Structure Of Leishmania Mexicana Triosephosphate
           Isomerase Complexed With Ipp
 pdb|1N55|A Chain A, 0.83a Resolution Structure Of The E65q Mutant Of
           Leishmania Mexicana Triosephosphate Isomerase Complexed
           With 2-Phosphoglycolate
 pdb|2VXN|A Chain A, E65q-Tim Complexed With Phosphoglycolohydroxamate At 0.82
           A Resolution
 pdb|2Y61|A Chain A, Crystal Structure Of Leishmanial E65q-Tim Complexed With
           S-Glycidol Phosphate
 pdb|2Y62|A Chain A, Crystal Structure Of Leishmanial E65q-Tim Complexed With
           R-Glycidol Phosphate
 pdb|2Y63|A Chain A, Crystal Structure Of Leishmanial E65q-Tim Complexed With
           Bromohydroxyacetone Phosphate
          Length = 251

 Score = 33.5 bits (75), Expect = 0.81,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 556 TFFHVDL-QTKLEAPKPVVIGYAALPLSTHAQLRSEISLPIIKELVPHYLQETGKERLDY 614
           TF H+ L Q KL  PK V+    A+  S       E+S+PI+K++  H++     ER  Y
Sbjct: 45  TFVHIPLVQAKLRNPKYVISAQNAIAKS--GAFTGEVSMPILKDIGVHWVILGHSERRTY 102


>pdb|1AMK|A Chain A, Leishmania Mexicana Triose Phosphate Isomerase
          Length = 251

 Score = 33.1 bits (74), Expect = 0.97,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 556 TFFHVDL-QTKLEAPKPVVIGYAALPLSTHAQLRSEISLPIIKELVPHYLQETGKERLDY 614
           TF H+ L Q KL  PK V+    A+  S       E+S+PI+K++  H++     ER  Y
Sbjct: 45  TFVHIPLVQAKLRNPKYVISAENAIAKS--GAFTGEVSMPILKDIGVHWVILGHSERRTY 102


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,915,289
Number of Sequences: 62578
Number of extensions: 1522866
Number of successful extensions: 3096
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 3094
Number of HSP's gapped (non-prelim): 6
length of query: 1372
length of database: 14,973,337
effective HSP length: 111
effective length of query: 1261
effective length of database: 8,027,179
effective search space: 10122272719
effective search space used: 10122272719
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)