Citrus Sinensis ID: 000661


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------137
MGLVMPVILQLVKLCVIGFAFTVQGSAGYGIPPSPAIIGGHFLLPRLPVTFTLKPHLLGGHAPSPIELPTHSAPPPVNIPSFSPSTPAVSAPFDMAPPPSLIPTNPVASPPSITAPPPVNMAPPPSLIPTTPVASPPPITAPPLVNVLPAPSLIPTTPLASPLSSKAFPPASPPSNAARPPASHPSNTARPPASHPSRTAPPPASHPSNTALPSKTAPSPASHPSNTALPPASLPSKTAPPPASHLSNTAPPPASHPYKTSPLPASHPSKTAPPPASHPSNTAPPPASHPSKTAPPPASHPSNTAPPPASHPSNTAPPPASHPSNTAPPPASHPSNTAPPPASHSSKTAPPPASHPSNTALPPASHPSNPAIPPASHPSNTAIPPASHPSNTAPPHASHPSNTALTPASHPSNIAPPPLFVPVLPSALPGKAPVSQSPISLPDAPAATPRGNFHRHSPAIHPSMPGPLPPVAQKRNASNREAPIAEPIAPGPFPPGNSRQKSPVARPIIPGGTPTASPDPDVPPSTPPLSVDGKRVGKPVAEPSYDIPMPPPVNHSPSKAPSTHKYMRHSNHSPLPPFSSPKPPQNNGNDTPVSSPLASFPKHRDVRNKIASSPAPSYFISPTTSIHQGPVVPPSFIPTSRKRHYGPPPLNSVSPSHSPLPTPVSRVPTSPSPSPTSASGQTELPLLPPKSSPSEPIRAFPPPPPNADCSTTICTEPYTNTPPGSPCGCVWPMQVGLRLSVALYTFFPLVSELAGEIAAGVFMKQSQVRIIGANAAEQPDKTVVLTDLVPLGEKFDNTTAFLTYQRFWHKQVVIKSSYFGDYEVLYVRYPGLPPSPPSASSSIGIIDDGPYSGNNGRATKPEGVDVPKRRQKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTSHVKPSGAAGLMVGSGLDSASLSFGSSIATYTGSAKTFSASEIEKATGNFDASRILGEGGFGLVYSGVLDDGTKVAVKVLKRVDQQGGREFLAEVEMLSRLHHRNLVKLIGICIEEQARCLVYELIPNGSVESHLHGVDKESAPLGWDARLKIALGAARALAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARSAMDEESRHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVILELLSGRKPVDMTQPPGQENLVAWARPLLTSREGLERIIDPSLGNDVPFDSVAKVAAIASMCVQPEVQHRPFMGEVVQALKLVCNECDEAKEVGSASSSQDDMSIDLDSKVSTGSGQLPDPLQRHYSVPNYDLGLDTGRRLSLSYLFSSSARSGKEESELFRRYSSSGPLRTGRGRQFWQRIRRLVGGSDSEHVGWNCRLVHA
cccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccHHHHHHHHHHccccccccEEEEEECccccccccEEEEEcccccccccHHHHHHHHHHHHcccEEEccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccECHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEEcccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccccccECcccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHHHHHHccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccc
**LVMPVILQLVKLCVIGFAFTVQGSAGYGIPPSPAIIGGHFLLPRLPVTFTLKPHLLG**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************STTICTEPYTNTPPGSPCGCVWPMQVGLRLSVALYTFFPLVSELAGEIAAGVFMKQSQVRIIGANAAEQPDKTVVLTDLVPLGEKFDNTTAFLTYQRFWHKQVVIKSSYFGDYEVLYVRYPG********************************************SGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSH*********************************************G***TFSASEIEKATGNFDASRILGEGGFGLVYSGVLDDGTKVAVKVLKRVDQQGGREFLAEVEMLSRLHHRNLVKLIGICIEEQARCLVYELIPNGSVESHLHGVDKESAPLGWDARLKIALGAARALAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARSAMDEESRHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVILELLSGRKPVDMTQPPGQENLVAWARPLLTSREGLERIIDPSLGNDVPFDSVAKVAAIASMCVQPEVQHRPFMGEVVQALKLVCNEC**************************************************************************************************************CRLVHA
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLVMPVILQLVKLCVIGFAFTVQGSAGYGIPPSPAIIGGHFLLPRLPVTFTLKPHLLGGHAPSPIELPTHSAPPPVNIPSFSPSTPAVSAPFDMAPPPSLIPTNPVASPPSITAPPPVNMAPPPSLIPTTPVASPPPITAPPLVNVLPAPSLIPTTPLASPLSSKAFPPASPPSNAARPPASHPSNTARPPASHPSRTAPPPASHPSNTALPSKTAPSPASHPSNTALPPASLPSKTAPPPASHLSNTAPPPASHPYKTSPLPASHPSKTAPPPASHPSNTAPPPASHPSKTAPPPASHPSNTAPPPASHPSNTAPPPASHPSNTAPPPASHPSNTAPPPASHSSKTAPPPASHPSNTALPPASHPSNPAIPPASHPSNTAIPPASHPSNTAPPHASHPSNTALTPASHPSNIAPPPLFVPVLPSALPGKAPVSQSPISLPDAPAATPRGNFHRHSPAIHPSMPGPLPPVAQKRNASNREAPIAEPIAPGPFPPGNSRQKSPVARPIIPGGTPTASPDPDVPPSTPPLSVDGKRVGKPVAEPSYDIPMPPPVNHSPSKAPSTHKYMRHSNHSPLPPFSSPKPPQNNGNDTPVSSPLASFPKHRDVRNKIASSPAPSYFISPTTSIHQGPVVPPSFIPTSRKRHYGPPPLNSVSPSHSPLPTPVSRVPTSPSPSPTSASGQTELPLLPPKSSPSEPIRAFPPPPPNADCSTTICTEPYTNTPPGSPCGCVWPMQVGLRLSVALYTFFPLVSELAGEIAAGVFMKQSQVRIIGANAAEQPDKTVVLTDLVPLGEKFDNTTAFLTYQRFWHKQVVIKSSYFGDYEVLYVRYPGLPPSPPSASSSIGIIDDGPYSGNNGRATKPEGVDVPKRRQKYGLSGGMIAIVVLSAFVAVVLCSAAAWVLLFKYKSHACQAEEVPQSLQTSHVKPSGAAGLMVGSGLDSASLSFGSSIATYTGSAKTFSASEIEKATGNFDASRILGEGGFGLVYSGVLDDGTKVAVKVLKRVDQQGGREFLAEVEMLSRLHHRNLVKLIGICIEEQARCLVYELIPNGSVESHLHGVDKESAPLGWDARLKIALGAARALAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARSAMDEESRHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVILELLSGRKPVDMTQPPGQENLVAWARPLLTSREGLERIIDPSLGNDVPFDSVAKVAAIASMCVQPEVQHRPFMGEVVQALKLVCNECDEAKEVGSASSSQDDMSIDLDSKVSTGSGQLPDPLQRHYSVPNYDLGLDTGRRLSLSYLFSSSARSGKEESELFRRYSSSGPLRTGRGRQFWQRIRRLVGGSDSEHVGWNCRLVHA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 954-1245
View the alignment between query and template
View the model in PyMOL
Template: 3G2F, chain A
Confidence level:very confident
Coverage over the Query: 977-1253
View the alignment between query and template
View the model in PyMOL
Template: 2J0J, chain A
Confidence level:confident
Coverage over the Query: 892-905,937-1173
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 229-303
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 329-425
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1twf, chain Aprobable Alignment | Template Structure
1twf, chain Aprobable Alignment | Template Structure