BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 000758
(1299 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2JCV|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Fosmidomycin And Nadph
pdb|2JCV|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Fosmidomycin And Nadph
pdb|2JD1|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese And Nadph
pdb|2JD1|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese And Nadph
pdb|2JD2|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese
pdb|2JD2|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese
pdb|3RAS|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase (Dxr) Complexed With A Lipophilic
Phosphonate Inhibitor
pdb|3RAS|B Chain B, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase (Dxr) Complexed With A Lipophilic
Phosphonate Inhibitor
pdb|2Y1C|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese.
pdb|2Y1C|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese.
pdb|2Y1D|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
Substituted Fosmidomycin Analogue And Manganese.
pdb|2Y1D|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
Substituted Fosmidomycin Analogue And Manganese.
pdb|2Y1E|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese.
pdb|2Y1E|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Manganese.
pdb|2Y1F|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
Substituted Fosmidomycin Analogue, Manganese And Nadph.
pdb|2Y1F|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
Substituted Fosmidomycin Analogue, Manganese And Nadph.
pdb|2Y1G|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
Substituted Fr900098 Analogue And Manganese.
pdb|2Y1G|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
Substituted Fr900098 Analogue And Manganese.
pdb|4A03|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Dxr In
Complex With The Antibiotic Fr900098 And Cofactor Nadph
pdb|4A03|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Dxr In
Complex With The Antibiotic Fr900098 And Cofactor Nadph
pdb|4AIC|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Fosmidomycin, Manganese
And Nadph
pdb|4AIC|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis, In Complex With Fosmidomycin, Manganese
And Nadph
Length = 398
Score = 32.3 bits (72), Expect = 1.6, Method: Composition-based stats.
Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 11/86 (12%)
Query: 260 FKYVRPGA-APIPGSATAVA----AGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQ 314
+ RPG P+ +A+A G P +V LV + + G RG W A ++ P Q
Sbjct: 148 LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLV-LTASGGPFRG-WSAADLEHVTPEQ 205
Query: 315 KGFHPGFGM----SASGVNMAGRGLE 336
G HP + M + + ++ +GLE
Sbjct: 206 AGAHPTWSMGPMNTLNSASLVNKGLE 231
>pdb|2C82|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis
pdb|2C82|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
Tuberculosis
Length = 413
Score = 32.0 bits (71), Expect = 2.1, Method: Composition-based stats.
Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 11/86 (12%)
Query: 260 FKYVRPGA-APIPGSATAVA----AGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQ 314
+ RPG P+ +A+A G P +V LV + + G RG W A ++ P Q
Sbjct: 139 LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLV-LTASGGPFRG-WSAADLEHVTPEQ 196
Query: 315 KGFHPGFGM----SASGVNMAGRGLE 336
G HP + M + + ++ +GLE
Sbjct: 197 AGAHPTWSMGPMNTLNSASLVNKGLE 222
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.129 0.375
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,413,512
Number of Sequences: 62578
Number of extensions: 1653661
Number of successful extensions: 2812
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 2785
Number of HSP's gapped (non-prelim): 29
length of query: 1299
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1189
effective length of database: 8,089,757
effective search space: 9618721073
effective search space used: 9618721073
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 57 (26.6 bits)