BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000765
         (1295 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2JCV|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Fosmidomycin And Nadph
 pdb|2JCV|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Fosmidomycin And Nadph
 pdb|2JD1|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese And Nadph
 pdb|2JD1|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese And Nadph
 pdb|2JD2|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese
 pdb|2JD2|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese
 pdb|3RAS|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase (Dxr) Complexed With A Lipophilic
           Phosphonate Inhibitor
 pdb|3RAS|B Chain B, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase (Dxr) Complexed With A Lipophilic
           Phosphonate Inhibitor
 pdb|2Y1C|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese.
 pdb|2Y1C|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese.
 pdb|2Y1D|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
           Substituted Fosmidomycin Analogue And Manganese.
 pdb|2Y1D|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
           Substituted Fosmidomycin Analogue And Manganese.
 pdb|2Y1E|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese.
 pdb|2Y1E|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Manganese.
 pdb|2Y1F|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
           Substituted Fosmidomycin Analogue, Manganese And Nadph.
 pdb|2Y1F|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
           Substituted Fosmidomycin Analogue, Manganese And Nadph.
 pdb|2Y1G|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
           Substituted Fr900098 Analogue And Manganese.
 pdb|2Y1G|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With A 3,4-Dichlorophenyl-
           Substituted Fr900098 Analogue And Manganese.
 pdb|4A03|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Dxr In
           Complex With The Antibiotic Fr900098 And Cofactor Nadph
 pdb|4A03|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Dxr In
           Complex With The Antibiotic Fr900098 And Cofactor Nadph
 pdb|4AIC|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Fosmidomycin, Manganese
           And Nadph
 pdb|4AIC|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis, In Complex With Fosmidomycin, Manganese
           And Nadph
          Length = 398

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 260 FKYVRPGA-APIPGSATAVA----AGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQ 314
            +  RPG   P+    +A+A     G P +V  LV +  + G  RG W  A ++   P Q
Sbjct: 148 LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLV-LTASGGPFRG-WSAADLEHVTPEQ 205

Query: 315 KGFHPGFGM----SASGVNMAGRGLE 336
            G HP + M    + +  ++  +GLE
Sbjct: 206 AGAHPTWSMGPMNTLNSASLVNKGLE 231


>pdb|2C82|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis
 pdb|2C82|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate
           Reductoisomerase, Dxr, Rv2870c, From Mycobacterium
           Tuberculosis
          Length = 413

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 260 FKYVRPGA-APIPGSATAVA----AGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQ 314
            +  RPG   P+    +A+A     G P +V  LV +  + G  RG W  A ++   P Q
Sbjct: 139 LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLV-LTASGGPFRG-WSAADLEHVTPEQ 196

Query: 315 KGFHPGFGM----SASGVNMAGRGLE 336
            G HP + M    + +  ++  +GLE
Sbjct: 197 AGAHPTWSMGPMNTLNSASLVNKGLE 222


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.129    0.376 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,393,734
Number of Sequences: 62578
Number of extensions: 1656056
Number of successful extensions: 2814
Number of sequences better than 100.0: 15
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 2779
Number of HSP's gapped (non-prelim): 31
length of query: 1295
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1185
effective length of database: 8,089,757
effective search space: 9586362045
effective search space used: 9586362045
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 57 (26.6 bits)