Citrus Sinensis ID: 000941


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210-----
MANLQMAAILEKITGKDKDFRYMATSDLLNELNKESFKADADLEVKLSNIVVQQLDDVAGDVSGLAVKCLAPLVKKVSEPRVVEMTDKLCIKLLNGKDQHRDIASIALKTIIAEVTTSSLAQSIHTSLTPQLTKGITLKDMNTEIRCECLDILCDVLHKFGNLMSNDHERLLSALLPQLSANQASVRKKSVSCIASLASSLSDDLLAKATIEVVRNLRSKGAKPEMIRTNIQMVGALSRAVGYRFGPHLGDTVPVLIDYCTSASENDEELREYSLQALESFLLRCPRDISSYCDEILHLTLEYLSYDPNFTDNMEEDSDDEAYEEEEEDESANEYTDDEDASWKVRRAAAKCLAALIVSRPEMLSKLYEEACPKLIDRFKEREENVKMDVFNTFIELVRQTGNVTKGQIDNNELNPRWLLKQEVSKIVKSINRQLREKSIKTKVGAFSVLRELVVVLPDCLADHIGSLIPGIEKSLNDKSSTSNLKIEALTFTRLVLSSHSPPVFHPYIKALSSPVLAAVGERYYKVTAEALRVCGELVRVLRPSVEGLGFDFKPYVQPIYNAIMSRLTNQDQDQEVKECAISCMGLVISTFGDNLGAELPACLPVLVDRMGNEITRLTAVKAFAVIAASPLHIDLTCVLEHVIAELTAFLRKANRALRQATLGTMNSLVVAYGDKIGASAYEVIIVELSTLISDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKVLPQALALIKSSLLQGQALVALQSFFAALVYSANTSFDTLLDSLLSSAKPSPQSGGVAKQAMYSIAQCVAVLCLAAGDQKCSSTVKMLTDILKDDSSTNSHLALLCLGEIGRRKDLSSHEHIENVIIESFQSPFEEIKSAASYALGNIAVGNLSKFLPFILDQIDNQQKKQYLLLHSLKEVIVRQSVDKAEFQDSSVEKILNLLFNHCESEEEGVRNVVAECLGKIALIEPAKLVPALKVRTTSSAAFTRATVVIAIKYSIVERPEKIDEIIFPEISSFLMLIKDQDRHVRRAAVLALSTFAHNKPNLIKGLLPELLPLLYDQTIVKKELIRTVDLGPFKHTVDDGLELRKAAFECVDTLLDSCLDQVNPSSFIVPYLKSGLEDHYDVKMPCHLILSKLADKCPSAVLAVLDSLVDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNQISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE
ccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccHHHcccHHHHccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHHcc
**NLQMAAILEKITGKDKDFRYMATSDLLNELNKESFKADADLEVKLSNIVVQQLDDVAGDVSGLAVKCLAPLVKKVSEPRVVEMTDKLCIKLLNGKDQHRDIASIALKTIIAEVTTSSLAQSIHTSLTPQLTKGITLKDMNTEIRCECLDILCDVLHKFGNLMSNDHERLLSALLPQLSANQASVRKKSVSCIASLASSLSDDLLAKATIEVVRNLRSKGAKPEMIRTNIQMVGALSRAVGYRFGPHLGDTVPVLIDYCTSASENDEELREYSLQALESFLLRCPRDISSYCDEILHLTLEYLSYDPNFTDNM*********************TDDEDASWKVRRAAAKCLAALIVSRPEMLSKLYEEACPKLIDRFKEREENVKMDVFNTFIELVRQTGNVTKGQIDNNELNPRWLLKQEVSKIVKSINRQLREKSIKTKVGAFSVLRELVVVLPDCLADHIGSLIPGIEKSLNDKSSTSNLKIEALTFTRLVLSSHSPPVFHPYIKALSSPVLAAVGERYYKVTAEALRVCGELVRVLRPSVEGLGFDFKPYVQPIYNAIMSRLTNQDQDQEVKECAISCMGLVISTFGDNLGAELPACLPVLVDRMGNEITRLTAVKAFAVIAASPLHIDLTCVLEHVIAELTAFLRKANRALRQATLGTMNSLVVAYGDKIGASAYEVIIVELSTLISDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKVLPQALALIKSSLLQGQALVALQSFFAALVYSANTSFDTLLDSLLSSAK**********QAMYSIAQCVAVLCLAAGDQKCSSTVKMLTDILKDDSSTNSHLALLCLGEIGRRKDLSSHEHIENVIIESFQSPFEEIKSAASYALGNIAVGNLSKFLPFILDQIDNQQKKQYLLLHSLKEVIVRQSVDKAEFQDSSVEKILNLLFNHCESEEEGVRNVVAECLGKIALIEPAKLVPALKVRTTSSAAFTRATVVIAIKYSIVERPEKIDEIIFPEISSFLMLIKDQDRHVRRAAVLALSTFAHNKPNLIKGLLPELLPLLYDQTIVKKELIRTVDLGPFKHTVDDGLELRKAAFECVDTLLDSCLDQVNPSSFIVPYLKSGLEDHYDVKMPCHLILSKLADKCPSAVLAVLDSLVDPLQKTINFKPKQDA**QEVDRNEDMIRSALRAIASLNQISGGDCSMKFKSLMSEISKSPMLWEKFYTIRN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLQMAAILEKITGKDKDFRYMATSDLLNELNKESFKADADLEVKLSNIVVQQLDDVAGDVSGLAVKCLAPLVKKVSEPRVVEMTDKLCIKLLNGKDQHRDIASIALKTIIAEVTTSSLAQSIHTSLTPQLTKGITLKDMNTEIRCECLDILCDVLHKFGNLMSNDHERLLSALLPQLSANQASVRKKSVSCIASLASSLSDDLLAKATIEVVRNLRSKGAKPEMIRTNIQMVGALSRAVGYRFGPHLGDTVPVLIDYCTSASENDEELREYSLQALESFLLRCPRDISSYCDEILHLTLEYLSYDPNFTDNMEEDSDDEAYEEEEEDESANEYTDDEDASWKVRRAAAKCLAALIVSRPEMLSKLYEEACPKLIDRFKEREENVKMDVFNTFIELVRQTGNVTKGQIDNNELNPRWLLKQEVSKIVKSINRQLREKSIKTKVGAFSVLRELVVVLPDCLADHIGSLIPGIEKSLNDKSSTSNLKIEALTFTRLVLSSHSPPVFHPYIKALSSPVLAAVGERYYKVTAEALRVCGELVRVLRPSVEGLGFDFKPYVQPIYNAIMSRLTNQDQDQEVKECAISCMGLVISTFGDNLGAELPACLPVLVDRMGNEITRLTAVKAFAVIAASPLHIDLTCVLEHVIAELTAFLRKANRALRQATLGTMNSLVVAYGDKIGASAYEVIIVELSTLISDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKVLPQALALIKSSLLQGQALVALQSFFAALVYSANTSFDTLLDSLLSSAKPSPQSGGVAKQAMYSIAQCVAVLCLAAGDQKCSSTVKMLTDILKDDSSTNSHLALLCLGEIGRRKDLSSHEHIENVIIESFQSPFEEIKSAASYALGNIAVGNLSKFLPFILDQIDNQQKKQYLLLHSLKEVIVRQSVDKAEFQDSSVEKILNLLFNHCESEEEGVRNVVAECLGKIALIEPAKLVPALKVRTTSSAAFTRATVVIAIKYSIVERPEKIDEIIFPEISSFLMLIKDQDRHVRRAAVLALSTFAHNKPNLIKGLLPELLPLLYDQTIVKKELIRTVDLGPFKHTVDDGLELRKAAFECVDTLLDSCLDQVNPSSFIVPYLKSGLEDHYDVKMPCHLILSKLADKCPSAVLAVLDSLVDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNQISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-associated NEDD8-dissociated protein 1 Required for SCF(TIR1) function. Modulates SCF(TIR1) function through its interactions with the CUL1 subunit. Positively regulates multiple E3 ubiquitin-protein ligase complexes and their associated developmental processes. Represses photomorphogenesis by promoting HY5 degradation in darkness.confidentQ8L5Y6
Cullin-associated NEDD8-dissociated protein 1 Enhances transcription from various types of promoters (By similarity). Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins.probableQ86VP6
Cullin-associated NEDD8-dissociated protein 1 Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins (By similarity). Enhances transcription from various types of promoters.probableP97536

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B3U, chain A
Confidence level:very confident
Coverage over the Query: 47-305,340-403,417-712
View the alignment between query and template
View the model in PyMOL
Template: 1B3U, chain A
Confidence level:very confident
Coverage over the Query: 4-305,340-402,416-669
View the alignment between query and template
View the model in PyMOL
Template: 4FDD, chain A
Confidence level:very confident
Coverage over the Query: 4-328,341-401,417-776
View the alignment between query and template
View the model in PyMOL
Template: 2BPT, chain A
Confidence level:very confident
Coverage over the Query: 8-305,340-776
View the alignment between query and template
View the model in PyMOL
Template: 4ADY, chain A
Confidence level:very confident
Coverage over the Query: 649-741,777-1050
View the alignment between query and template
View the model in PyMOL
Template: 4ADY, chain A
Confidence level:confident
Coverage over the Query: 811-1054,1072-1154
View the alignment between query and template
View the model in PyMOL
Template: 3IBV, chain A
Confidence level:confident
Coverage over the Query: 17-767
View the alignment between query and template
View the model in PyMOL
Template: 3NOW, chain A
Confidence level:confident
Coverage over the Query: 374-402,418-1054,1070-1092
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1u6g, chain Cvery confident Alignment | Template Structure