Citrus Sinensis ID: 000965
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1207 | 2.2.26 [Sep-21-2011] | |||||||
| O65272 | 1174 | K(+) efflux antiporter 2, | yes | no | 0.963 | 0.990 | 0.706 | 0.0 | |
| Q9ZTZ7 | 1193 | K(+) efflux antiporter 1, | no | no | 0.977 | 0.989 | 0.691 | 0.0 | |
| Q9M0Z3 | 776 | K(+) efflux antiporter 3, | no | no | 0.450 | 0.701 | 0.369 | 7e-92 | |
| B4TJ42 | 620 | Glutathione-regulated pot | yes | no | 0.458 | 0.891 | 0.367 | 3e-84 | |
| A8AQP0 | 601 | Glutathione-regulated pot | yes | no | 0.449 | 0.901 | 0.365 | 9e-84 | |
| B4TWT1 | 620 | Glutathione-regulated pot | yes | no | 0.458 | 0.891 | 0.367 | 2e-83 | |
| B1JIU4 | 602 | Glutathione-regulated pot | yes | no | 0.454 | 0.911 | 0.371 | 4e-83 | |
| Q664Q5 | 602 | Glutathione-regulated pot | yes | no | 0.454 | 0.911 | 0.371 | 4e-83 | |
| A4TGX5 | 602 | Glutathione-regulated pot | yes | no | 0.454 | 0.911 | 0.371 | 4e-83 | |
| Q1CCS7 | 602 | Glutathione-regulated pot | yes | no | 0.454 | 0.911 | 0.371 | 4e-83 |
| >sp|O65272|KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana GN=KEA2 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 1535 bits (3975), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 861/1218 (70%), Positives = 985/1218 (80%), Gaps = 55/1218 (4%)
Query: 1 MGFACGLQQPNVFEG----TRYRISDRLINSRFRYGGFG-YNVSNRRIVSKTRSTRNLSK 55
M FA +Q+ ++F G Y + +R+I+++ G G + I SK RS +
Sbjct: 1 MDFASSVQRQSMFHGGADFASYCLPNRMISAKLCPKGLGGTRFWDPMIDSKVRSAIRSKR 60
Query: 56 SISYAGCSKSSLVFRGNSDANLWG-LYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFID 114
++SY +SSL + + +G L K + G CQ +DS+ +
Sbjct: 61 NVSY----RSSLTLNADFNGRFYGHLLPAKP--------QNVPLGFRLLCQSSDSVGDLV 108
Query: 115 GNGRNVEFSENGDGPEANSLGEEERETKEDAEPPTTDELRELLMNAMKELEVAQLNSTMF 174
GN RN+EF+E D E + +EE++T+E P+ +ELR+LL A KELEVA LNSTMF
Sbjct: 109 GNDRNLEFAEGSDDREV-TFSKEEKDTREQDSAPSLEELRDLLNKATKELEVASLNSTMF 167
Query: 175 EEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARL 234
EEKAQRISE AIALKDEAA+AWN+VN TL++V E V+EE +AKEAV KATMALSLAEARL
Sbjct: 168 EEKAQRISEVAIALKDEAASAWNDVNQTLNVVQEAVDEESVAKEAVQKATMALSLAEARL 227
Query: 235 QVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQANLANCETELRRL 294
QVA+ESL E + S E + + K+++ LL+A+ DIKECQ NLA+CE +LRRL
Sbjct: 228 QVALESL-----EAEGYNTSEESEVRDGVKDKEEALLSAKADIKECQENLASCEEQLRRL 282
Query: 295 QSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIAL 354
Q KK+ELQKEVDRLNE AE+AQ++ALKAEEDVANIM+LAEQAVAFE+EATQRVNDAEIAL
Sbjct: 283 QVKKDELQKEVDRLNEAAERAQISALKAEEDVANIMVLAEQAVAFELEATQRVNDAEIAL 342
Query: 355 QRAEKSLSNSSVDISERIKGYV-SGDETAVKEEKAGS-TDDVN--VERDIDVPVNGDYLV 410
QRAEK+L S E +G V G T V E++ S DV+ ERD+ V +
Sbjct: 343 QRAEKTLFGSQTQ--ETTQGKVLDGKNTIVGEDEVLSEIVDVSHQAERDLVVVGVSSDVG 400
Query: 411 SESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTKKQEMQ 470
++S Y+SD ENGK D KEAE EAEKSKNV+ TKKQE+Q
Sbjct: 401 TQS----------------YESD----NENGKPTADFAKEAEGEAEKSKNVVLTKKQEVQ 440
Query: 471 KDLTRESSPVNAPKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARKQLPKLVL 530
KDL RESS N KT KKSSRFFPASFFSS DGT A++F+ L+E A++Q PKL+L
Sbjct: 441 KDLPRESSSHNGTKTSLKKSSRFFPASFFSSNGDGT----ATVFESLVESAKQQWPKLIL 496
Query: 531 GFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDM 590
GF L GAGVA Y+N R++ QQP++++TS E+ SS+ KPLIR+++KLPKRIKKLL+M
Sbjct: 497 GFTLLGAGVAIYSNGVGRNNQLPQQPNIVSTSAEDVSSSTKPLIRQMQKLPKRIKKLLEM 556
Query: 591 LPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHV 650
P+QE+NEEEASL DVLWLLLASVIFVP+FQKIPGGSPVLGYLAAGILIGPYGLSIIR+V
Sbjct: 557 FPQQEVNEEEASLLDVLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRNV 616
Query: 651 HGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLP 710
HGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTA V+GL+ H+V+G
Sbjct: 617 HGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAAVIGLITHYVAGQA 676
Query: 711 GPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISP 770
GPA+IVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISP
Sbjct: 677 GPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISP 736
Query: 771 NSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLL 830
NSSKGG+GFQAIAEALG+AA+KAAVAIT IIAGGRLLLRPIYKQIAEN+NAEIFSANTLL
Sbjct: 737 NSSKGGIGFQAIAEALGLAAIKAAVAITGIIAGGRLLLRPIYKQIAENRNAEIFSANTLL 796
Query: 831 VILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSID 890
VILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSID
Sbjct: 797 VILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSID 856
Query: 891 PKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGE 950
PKLLL+NFP+I G LGLL+ GKTILV ++G+LFG+S+ISA+R GLLLAPGGEFAFVAFGE
Sbjct: 857 PKLLLANFPLIMGTLGLLLVGKTILVVIIGKLFGISIISAVRVGLLLAPGGEFAFVAFGE 916
Query: 951 AVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQD 1010
AVNQGIM+ QLSSLLFL+VGISMALTPWLAAGGQLIASRFE DVRSLLPVESETDDLQ
Sbjct: 917 AVNQGIMTPQLSSLLFLVVGISMALTPWLAAGGQLIASRFELQDVRSLLPVESETDDLQG 976
Query: 1011 HIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVG 1070
HII+CGFGR+GQIIAQLLSERLIPFVALDV SDRVAIGR+LDLPVYFGDAGSREVLHK+G
Sbjct: 977 HIIICGFGRIGQIIAQLLSERLIPFVALDVSSDRVAIGRSLDLPVYFGDAGSREVLHKIG 1036
Query: 1071 AERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLE 1130
A+RACAAAI LDTPGANYR VWALSKYFPNVKTFVRAHD+DHGLNLEKAGATAVVPETLE
Sbjct: 1037 ADRACAAAIALDTPGANYRCVWALSKYFPNVKTFVRAHDVDHGLNLEKAGATAVVPETLE 1096
Query: 1131 PSLQLAAAVLAQAKLPASEIAATINEFRTRHLSELTELCQASGSSLGYGISRVMSKPKAQ 1190
PSLQLAAAVLAQAKLP SEIA TINEFR+RHLSEL ELC+ASGSSLGYG SR SKPK
Sbjct: 1097 PSLQLAAAVLAQAKLPTSEIATTINEFRSRHLSELAELCEASGSSLGYGFSRSTSKPKPP 1156
Query: 1191 S-SDSSDESQVAEGTLAI 1207
S S++SD++Q+ EGTLAI
Sbjct: 1157 SPSETSDDNQIIEGTLAI 1174
|
May operate as a K(+)/H(+) antiporter. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9ZTZ7|KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana GN=KEA1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9M0Z3|KEA3_ARATH K(+) efflux antiporter 3, chloroplastic OS=Arabidopsis thaliana GN=KEA3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|B4TJ42|KEFC_SALHS Glutathione-regulated potassium-efflux system protein KefC OS=Salmonella heidelberg (strain SL476) GN=kefC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A8AQP0|KEFB_CITK8 Glutathione-regulated potassium-efflux system protein KefB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=kefB PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B4TWT1|KEFC_SALSV Glutathione-regulated potassium-efflux system protein KefC OS=Salmonella schwarzengrund (strain CVM19633) GN=kefC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B1JIU4|KEFB_YERPY Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kefB PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q664Q5|KEFB_YERPS Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kefB PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A4TGX5|KEFB_YERPP Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis (strain Pestoides F) GN=kefB PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q1CCS7|KEFB_YERPN Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kefB PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1207 | ||||||
| 255541526 | 1228 | Glutathione-regulated potassium-efflux s | 0.995 | 0.978 | 0.777 | 0.0 | |
| 225454115 | 1207 | PREDICTED: K(+) efflux antiporter 2, chl | 0.978 | 0.978 | 0.755 | 0.0 | |
| 356522640 | 1206 | PREDICTED: K(+) efflux antiporter 2, chl | 0.916 | 0.917 | 0.741 | 0.0 | |
| 449433089 | 1212 | PREDICTED: K(+) efflux antiporter 2, chl | 0.985 | 0.981 | 0.734 | 0.0 | |
| 356568360 | 1109 | PREDICTED: K(+) efflux antiporter 2, chl | 0.902 | 0.981 | 0.758 | 0.0 | |
| 356506274 | 1203 | PREDICTED: K(+) efflux antiporter 2, chl | 0.910 | 0.913 | 0.744 | 0.0 | |
| 356532026 | 1107 | PREDICTED: K(+) efflux antiporter 2, chl | 0.899 | 0.981 | 0.757 | 0.0 | |
| 240255705 | 1174 | K(+) efflux antiporter 2 [Arabidopsis th | 0.963 | 0.990 | 0.706 | 0.0 | |
| 334186250 | 1185 | K(+) efflux antiporter 2 [Arabidopsis th | 0.963 | 0.981 | 0.700 | 0.0 | |
| 297848322 | 1171 | hypothetical protein ARALYDRAFT_311263 [ | 0.967 | 0.997 | 0.694 | 0.0 |
| >gi|255541526|ref|XP_002511827.1| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] gi|223549007|gb|EEF50496.1| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1760 bits (4558), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 959/1233 (77%), Positives = 1047/1233 (84%), Gaps = 31/1233 (2%)
Query: 1 MGFACGLQQPNVFEG---TRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSI 57
M AC +QQPN F G T YR+ RL +S RY F YNV + IV K RS++ SK +
Sbjct: 1 MDLACSIQQPNAFHGSEVTCYRVPGRLYSSS-RYRSFRYNVVDPSIVLKDRSSKKRSKIL 59
Query: 58 SYAG-CSKSSLVFRGNSDANLWGLYT-CKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDG 115
+Y G C SSLVF ++L ++ S +CS + +G CQGNDSLA+++G
Sbjct: 60 AYNGSCLNSSLVFGRGFQSHLSCAHSNISSFYCSLGGGFNVLKGAKLHCQGNDSLAYVNG 119
Query: 116 NGRNVEFSENG---------DGPEANSLGEEERETKED-AEPPTTDELRELLMNAMKELE 165
N RNVEF E DG E LGE E E KE AE + DEL+ELL A++ELE
Sbjct: 120 NDRNVEFVEGSAESSRVGSEDGVELIRLGENEGEQKEVVAEASSLDELKELLQKALRELE 179
Query: 166 VAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATM 225
+A+LNSTMFEEKAQRISE AIALKDEAANAW+NVN TLD + +VNEE +AKEA+ ATM
Sbjct: 180 IARLNSTMFEEKAQRISETAIALKDEAANAWDNVNSTLDTIQGVVNEEAVAKEAIQNATM 239
Query: 226 ALSLAEARLQVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQANLA 285
ALSLAEARL+VA+ES+ K E D P GS D D ++ED L A+++I ECQ NL
Sbjct: 240 ALSLAEARLRVAVESIDSAKGETDSPHGSGVSDVVKDIRKEDEALSDAQDEIIECQMNLG 299
Query: 286 NCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQ 345
NCE ELRRLQSKKEELQKEVDRLNEVAEKAQM+ALKAEEDVAN+MLLAEQAVAFE+EATQ
Sbjct: 300 NCEAELRRLQSKKEELQKEVDRLNEVAEKAQMDALKAEEDVANVMLLAEQAVAFELEATQ 359
Query: 346 RVNDAEIALQRAEKSLSNSSVDISERIKGYVSGDETAVKEEKAGSTDDVNVERDIDVPVN 405
RVNDAEIALQRAEK LS+SSVD E +GYVSGDE +EEK + E++ D ++
Sbjct: 360 RVNDAEIALQRAEKLLSSSSVD-KETTQGYVSGDEAVREEEKWSEGRTADDEKERDASID 418
Query: 406 GDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTK 465
D LV E S D L DK SQSS+ELY SD+ D ENGKLNLDS KE EVEAEKSK+ +Q K
Sbjct: 419 ADLLVGEPSIDGLLDKASQSSKELYHSDDSSDCENGKLNLDSLKEVEVEAEKSKSGVQPK 478
Query: 466 KQEMQKDLTRESS--PVNAPKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARK 523
KQEMQKD+TRESS P N+PK L KKSSRFF ASFFS VDGTE T AS+FQGL++ A++
Sbjct: 479 KQEMQKDITRESSASPTNSPKALLKKSSRFFSASFFSFTVDGTELTPASVFQGLIQSAKQ 538
Query: 524 QLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKR 583
Q+PKL+LG +LFGAGVAFY+N+AERS+ LQQ DV+TTSIEE SSNAKPLIR ++KLPKR
Sbjct: 539 QMPKLILGLVLFGAGVAFYSNRAERSTQMLQQTDVVTTSIEEVSSNAKPLIRHIQKLPKR 598
Query: 584 IKKLLDMLPEQE---------INEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLA 634
IKKLL MLP QE +NEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLA
Sbjct: 599 IKKLLAMLPHQEAYFPFTLFWMNEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLA 658
Query: 635 AGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLV 694
AGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLG+AQVLV
Sbjct: 659 AGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGTAQVLV 718
Query: 695 TAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ 754
TAV VGL +HFVSGLPGPA+IV+GNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ
Sbjct: 719 TAVAVGLGSHFVSGLPGPAAIVVGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ 778
Query: 755 DLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQ 814
DLAVVVLLILIPLISPNSSKGGVGFQAIAEALG+AAVKAA+AITAIIAGGRLLLRPIYKQ
Sbjct: 779 DLAVVVLLILIPLISPNSSKGGVGFQAIAEALGLAAVKAALAITAIIAGGRLLLRPIYKQ 838
Query: 815 IAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYR 874
IAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYR
Sbjct: 839 IAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYR 898
Query: 875 GLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTG 934
GLLLGLFFMTVGMSIDPKLL+SNFPVI G LGLLIGGKT+LVALVGRLFG+S+ISAIR G
Sbjct: 899 GLLLGLFFMTVGMSIDPKLLISNFPVIMGTLGLLIGGKTLLVALVGRLFGISIISAIRVG 958
Query: 935 LLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHD 994
LLLAPGGEFAFVAFGEAVNQGIMS QLSSLLFL+VGISMALTPWLAAGGQLIASRFEQHD
Sbjct: 959 LLLAPGGEFAFVAFGEAVNQGIMSPQLSSLLFLVVGISMALTPWLAAGGQLIASRFEQHD 1018
Query: 995 VRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLP 1054
VRSLLPVESETDDLQDHII+CGFGRVGQIIAQLLSERLIPFVALDVRSDRVA+GRALDLP
Sbjct: 1019 VRSLLPVESETDDLQDHIIICGFGRVGQIIAQLLSERLIPFVALDVRSDRVAVGRALDLP 1078
Query: 1055 VYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGL 1114
V+FGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHD+DHGL
Sbjct: 1079 VFFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDVDHGL 1138
Query: 1115 NLEKAGATAVVPETLEPSLQLAAAVLAQAKLPASEIAATINEFRTRHLSELTELCQASGS 1174
NLEKAGATAVVPETLEPSLQLAAAVLAQAKLP SEIA+TINEFR+RHLSELTELC+ASGS
Sbjct: 1139 NLEKAGATAVVPETLEPSLQLAAAVLAQAKLPTSEIASTINEFRSRHLSELTELCEASGS 1198
Query: 1175 SLGYGISRVMSKPKAQSSDSSDESQVAEGTLAI 1207
SLGYG SR KPKAQ SD SDE+QV EGTLAI
Sbjct: 1199 SLGYGFSR---KPKAQLSDPSDENQVTEGTLAI 1228
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225454115|ref|XP_002269352.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356522640|ref|XP_003529954.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449433089|ref|XP_004134330.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cucumis sativus] gi|449480375|ref|XP_004155876.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356568360|ref|XP_003552379.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356506274|ref|XP_003521911.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356532026|ref|XP_003534575.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|240255705|ref|NP_191972.6| K(+) efflux antiporter 2 [Arabidopsis thaliana] gi|298351840|sp|O65272.2|KEA2_ARATH RecName: Full=K(+) efflux antiporter 2, chloroplastic; Short=AtKEA2 gi|332656511|gb|AEE81911.1| K(+) efflux antiporter 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186250|ref|NP_001190645.1| K(+) efflux antiporter 2 [Arabidopsis thaliana] gi|332656512|gb|AEE81912.1| K(+) efflux antiporter 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297848322|ref|XP_002892042.1| hypothetical protein ARALYDRAFT_311263 [Arabidopsis lyrata subsp. lyrata] gi|297337884|gb|EFH68301.1| hypothetical protein ARALYDRAFT_311263 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1207 | ||||||
| TAIR|locus:2198215 | 1193 | KEA1 "K+ efflux antiporter 1" | 0.951 | 0.963 | 0.618 | 0.0 | |
| TIGR_CMR|APH_1305 | 571 | APH_1305 "glutathione-regulate | 0.452 | 0.956 | 0.356 | 2.2e-80 | |
| TIGR_CMR|ECH_0146 | 568 | ECH_0146 "putative glutathione | 0.269 | 0.572 | 0.347 | 5.1e-75 | |
| TIGR_CMR|NSE_0885 | 578 | NSE_0885 "glutathione-regulate | 0.269 | 0.562 | 0.346 | 1e-74 | |
| UNIPROTKB|Q0C665 | 601 | kefC "Glutathione-regulated po | 0.461 | 0.926 | 0.314 | 5.9e-63 | |
| UNIPROTKB|Q9KNX4 | 656 | VC_2606 "Glutathione-regulated | 0.415 | 0.765 | 0.326 | 6.9e-61 | |
| TIGR_CMR|VC_2606 | 656 | VC_2606 "glutathione-regulated | 0.415 | 0.765 | 0.326 | 6.9e-61 | |
| TIGR_CMR|SO_1481 | 589 | SO_1481 "glutathione-regulated | 0.261 | 0.536 | 0.328 | 2.4e-60 | |
| UNIPROTKB|P03819 | 620 | kefC [Escherichia coli K-12 (t | 0.426 | 0.830 | 0.322 | 1.8e-59 | |
| TIGR_CMR|SO_1647 | 648 | SO_1647 "glutathione-regulated | 0.262 | 0.489 | 0.320 | 3.6e-57 |
| TAIR|locus:2198215 KEA1 "K+ efflux antiporter 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3372 (1192.1 bits), Expect = 0., P = 0.
Identities = 722/1168 (61%), Positives = 843/1168 (72%)
Query: 45 SKTRSTRNLSKSISYAGC-SKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPT 103
SK S L ++++ +G + + F G + L++ KS+ + ++ G
Sbjct: 40 SKVHSCFRLRRNVAQSGTLNLMNACFSGRFYSG--HLHSTKSILGNGHQAKRIPFGFRLR 97
Query: 104 CQGNDSLAFIDGNGRNV-EFSENGDGPEANSLGEEERETKEDAEPPTTDELRELLMNAMK 162
CQG++SL D N + E SE+ D EA L + E D+ +EL+ELL A+K
Sbjct: 98 CQGHESLGNADSNDHRIGESSESSDETEATDLKDARVENDTDS----LEELKELLHKAIK 153
Query: 163 ELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHK 222
ELEVA+LNSTMFEEKAQRISE AIALKDEAA AW +VN TLD++ + V EE +AKEAV
Sbjct: 154 ELEVARLNSTMFEEKAQRISERAIALKDEAATAWLDVNKTLDVIRDTVYEEALAKEAVQT 213
Query: 223 ATMALSLAEARLQVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQA 282
ATMALSLAEARLQV +ESL+ +D P S E + D +++ LLAA++DIKECQ
Sbjct: 214 ATMALSLAEARLQVIVESLE-AGAGNDIPHVSEETEETIDVNDKEEALLAAKDDIKECQV 272
Query: 283 NLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIE 342
NL NCE++L L SKK+ELQKEVD+LNE AE Q+++LKAEEDV NIM LAEQAVAFE+E
Sbjct: 273 NLDNCESQLSALLSKKDELQKEVDKLNEFAETIQISSLKAEEDVTNIMKLAEQAVAFELE 332
Query: 343 ATQRVNDAEIALQRAEKSLSNSSVDISERIKGYVSGDETAVKEEK--AGSTDDVNVERDI 400
ATQRVNDAEIALQRAEKSLS S E +G +S +ET+ ++ +G+ +DV + +
Sbjct: 333 ATQRVNDAEIALQRAEKSLSISQTP--EETQGQLSDEETSQEDAMVLSGNVEDVTHQVEK 390
Query: 401 DVPVNGDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKN 460
+ P +GD V + + +++PD V Q +++L Q E D ENGK +++S K E ++EK K
Sbjct: 391 ESPKDGDLPVVQITAELVPDIVGQRNKKLTQPYESSDHENGKPSVESSKVVEADSEKPKI 450
Query: 461 VIQTKKQEMQKDLTRESSPVNAPKTLQKKXXXXXXXXXXXXXVDGTESTQASIFQGLMEY 520
+QTKKQE QKDL +E S +N+PK K DGT A++F L+
Sbjct: 451 NVQTKKQETQKDLPKEGSSLNSPKASFNKSSRFFSASFFSSNPDGT----ATVFGSLVGS 506
Query: 521 ARKQLPKXXXXXXXXXXXXXXYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKL 580
++Q PK Y+N ++ LQQPDV +TS E+ SS+ KPLIR+V+KL
Sbjct: 507 VKQQWPKLVLGLALLGAGLTLYSNGVGGNNQLLQQPDVTSTSTEDVSSSTKPLIRQVQKL 566
Query: 581 PKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIG 640
PKRIKKLL+M+P QE+NEEEASLFD LWLLLASVIFVP+FQKIPGGSPVLGYLAAGILIG
Sbjct: 567 PKRIKKLLEMIPHQEVNEEEASLFDFLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIG 626
Query: 641 PYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQXXXXXXXXX 700
PYGLSIIR+VHGT+AIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQ
Sbjct: 627 PYGLSIIRNVHGTRAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAAVVG 686
Query: 701 XXXXXXSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDXXXXX 760
+G GPA+IVIGNGLALSSTAVVLQVLQERGESTSRHGRA+FSVLLFQD
Sbjct: 687 LLAHYVAGQAGPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRASFSVLLFQDLAVVV 746
Query: 761 XXXXXXXXSPNSSKGGVGFQXXXXXXXXXXXXXXXXXXXXXXXXRLLLRPIYKQIAENQN 820
SPNSSKGG+GFQ RLLLRPIYKQIAEN+N
Sbjct: 747 LLILIPLISPNSSKGGIGFQAIAEALGLAAVKAAVAITAIIAGGRLLLRPIYKQIAENRN 806
Query: 821 AEIFSANTLLVILGTSLLTARXXXXXXXXXXXXXXXXXETEFSLQVESDIAPYRGLLLGL 880
AEIFSANTLLVILGTSLLTAR ETEFSLQVESDIAPYRGLLLGL
Sbjct: 807 AEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGL 866
Query: 881 FFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPG 940
FFMTVGMSIDPKLLLSNFPVI G LGLLI GKT+LV ++G+LFG+S+ISAIR GLLLAPG
Sbjct: 867 FFMTVGMSIDPKLLLSNFPVIVGTLGLLIVGKTMLVVIMGKLFGISIISAIRVGLLLAPG 926
Query: 941 GEFAFVAFGEAVNQGIMXXXXXXXXXXXVGISMALTPWLAAGGQLIASRFEQHDVRSLLP 1000
GEFAFVAFGEAVNQGIM VGISMA+TPWLAAGGQLIASRFE HDVRSLLP
Sbjct: 927 GEFAFVAFGEAVNQGIMSPQLSSLLFLVVGISMAITPWLAAGGQLIASRFELHDVRSLLP 986
Query: 1001 VESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDA 1060
VESETDDLQ HII+CGFGRVGQIIAQLLSERLIPFVALDV SDRV IGR+LDLPVYFGDA
Sbjct: 987 VESETDDLQGHIIICGFGRVGQIIAQLLSERLIPFVALDVSSDRVTIGRSLDLPVYFGDA 1046
Query: 1061 GSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAG 1120
GS+EVLHK+GA RACAA + LD PGANYR VWALSK++PNVKTFVRAHD+ HGLNLEKAG
Sbjct: 1047 GSKEVLHKIGAGRACAAVVALDAPGANYRCVWALSKFYPNVKTFVRAHDVVHGLNLEKAG 1106
Query: 1121 ATAVVPETLEPSXXXXXXXXXXXXXXXSEIAATINEFRTRHLSELTELCQASGSSLGYGI 1180
ATAVVPETLEPS SEIA TINEFRTRHLSELTELC+ASGSSLGYG
Sbjct: 1107 ATAVVPETLEPSLQLAAAVLAQAKLPTSEIANTINEFRTRHLSELTELCEASGSSLGYGY 1166
Query: 1181 SRVMSKPKAQSSDSSDESQVAEG-TLAI 1207
SR SKPK Q SD+S ++Q+ EG T+ I
Sbjct: 1167 SRT-SKPKPQPSDASGDNQIIEGGTVVI 1193
|
|
| TIGR_CMR|APH_1305 APH_1305 "glutathione-regulated potassium-efflux system protein" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0146 ECH_0146 "putative glutathione-regulated potassium-efflux system protein KefB" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0885 NSE_0885 "glutathione-regulated potassium-efflux system protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0C665 kefC "Glutathione-regulated potassium-efflux system protein KefC" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KNX4 VC_2606 "Glutathione-regulated potassium-efflux system protein KefB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2606 VC_2606 "glutathione-regulated potassium-efflux system protein KefB" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1481 SO_1481 "glutathione-regulated potassium-efflux system protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P03819 kefC [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1647 SO_1647 "glutathione-regulated potassium-efflux system protein KefB, putative" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O65272 | KEA2_ARATH | No assigned EC number | 0.7068 | 0.9635 | 0.9906 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | KEA2 | KEA2; potassium ion transmembrane transporter/ potassium-hydrogen antiporter; member of Putative potassium transporter family (1174 aa) | |||||||||
(Arabidopsis thaliana) | |||||||||||
 | AT3G49560 | • | 0.679 | ||||||||
 | AT5G24650 | • | 0.675 | ||||||||
 | ATNAP11 | • | 0.599 | ||||||||
 | MAPR3 | • | 0.567 | ||||||||
 | TGD1 | • | 0.507 | ||||||||
 | TGD2 | • | 0.506 | ||||||||
 | CHX25 | • | 0.502 | ||||||||
 | TOC159 | • | 0.497 | ||||||||
 | CHX6B | • | 0.467 | ||||||||
 | CHX11 | • | 0.462 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1207 | |||
| PRK03562 | 621 | PRK03562, PRK03562, glutathione-regulated potassiu | 1e-137 | |
| PRK03659 | 601 | PRK03659, PRK03659, glutathione-regulated potassiu | 1e-119 | |
| TIGR00932 | 273 | TIGR00932, 2a37, transporter, monovalent cation:pr | 5e-99 | |
| COG0475 | 397 | COG0475, KefB, Kef-type K+ transport systems, memb | 1e-86 | |
| pfam00999 | 370 | pfam00999, Na_H_Exchanger, Sodium/hydrogen exchang | 2e-60 | |
| PRK10669 | 558 | PRK10669, PRK10669, putative cation:proton antipor | 5e-53 | |
| COG4651 | 408 | COG4651, RosB, Kef-type K+ transport system, predi | 6e-50 | |
| COG1226 | 212 | COG1226, Kch, Kef-type K+ transport systems, predi | 1e-23 | |
| pfam02254 | 116 | pfam02254, TrkA_N, TrkA-N domain | 8e-22 | |
| COG0025 | 429 | COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiport | 7e-16 | |
| COG0569 | 225 | COG0569, TrkA, K+ transport systems, NAD-binding c | 1e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| PRK05326 | 562 | PRK05326, PRK05326, potassium/proton antiporter; R | 4e-07 | |
| PLN03159 | 832 | PLN03159, PLN03159, cation/H(+) antiporter 15; Pro | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-04 | |
| pfam03956 | 191 | pfam03956, DUF340, Membrane protein of unknown fun | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.002 | |
| TIGR03082 | 156 | TIGR03082, Gneg_AbrB_dup, membrane protein AbrB du | 0.002 | |
| TIGR00924 | 475 | TIGR00924, yjdL_sub1_fam, amino acid/peptide trans | 0.002 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.004 |
| >gnl|CDD|235131 PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
Score = 430 bits (1107), Expect = e-137
Identities = 211/559 (37%), Positives = 314/559 (56%), Gaps = 16/559 (2%)
Query: 610 LLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIG 669
L A+V+ VPI ++ GS VLGYL AG +IGP+GL ++ V AEFGVV +LF IG
Sbjct: 14 LGAAVLIVPIAVRLGLGS-VLGYLIAGCIIGPWGLRLVTDVESILHFAEFGVVLMLFVIG 72
Query: 670 LELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVV 729
LEL +RL +++ +FG G+ Q++ ++GL + GL +++IG GLALSSTA+
Sbjct: 73 LELDPQRLWKLRRSIFGGGALQMVACGGLLGLFCMLL-GLRWQVALLIGLGLALSSTAIA 131
Query: 730 LQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVA 789
+Q + ER ++ GR+ F++LLFQD+A + L+ +IPL++ + + +G A ++
Sbjct: 132 MQAMNERNLMVTQMGRSAFAILLFQDIAAIPLVAMIPLLAASGASTTLG------AFALS 185
Query: 790 AVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALG 849
A+K A A+ ++ GGR + RP + +A + E+F+A L ++ G LL GLSMALG
Sbjct: 186 ALKVAGALALVVLGGRYVTRPALRFVARSGLREVFTAVALFLVFGFGLLMEEVGLSMALG 245
Query: 850 AFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLI 909
AFLAG+LLA +E+ +ESDI P++GLLLGLFF+ VGMSID LL N I L +
Sbjct: 246 AFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIAVGMSIDFGTLLENPLRILILLLGFL 305
Query: 910 GGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLV 969
K ++ L+ R GV +LL GGEFAFV FG A ++ + + LL L V
Sbjct: 306 AIKIAMLWLLARPLGVPRKQRRWFAVLLGQGGEFAFVVFGAAQMANVLEPEWAKLLTLAV 365
Query: 970 GISMALTP-WLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLL 1028
+SMA TP L +L SR E+ E D+ Q +I+ GFGR GQI+ +LL
Sbjct: 366 ALSMAATPLLLVLLDRLEQSRTEE------AREADEIDEQQPRVIIAGFGRFGQIVGRLL 419
Query: 1029 SERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANY 1088
+ LD D + R + V++GDA ++L GA +A +D P +
Sbjct: 420 LSSGVKMTVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTSL 479
Query: 1089 RTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPAS 1148
+ V + ++FP+++ RA D+DH + L +AG ET E +L+ VL L
Sbjct: 480 QLVELVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKSGRLVLESLGLGPY 539
Query: 1149 EIAATINEFRTRHLSELTE 1167
E + FR RH ++ E
Sbjct: 540 EARERADRFR-RHNLQMVE 557
|
Length = 621 |
| >gnl|CDD|179625 PRK03659, PRK03659, glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233195 TIGR00932, 2a37, transporter, monovalent cation:proton antiporter-2 (CPA2) family | Back alignment and domain information |
|---|
| >gnl|CDD|223551 COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216235 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family | Back alignment and domain information |
|---|
| >gnl|CDD|182633 PRK10669, PRK10669, putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226998 COG4651, RosB, Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224147 COG1226, Kch, Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216949 pfam02254, TrkA_N, TrkA-N domain | Back alignment and domain information |
|---|
| >gnl|CDD|223104 COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235410 PRK05326, PRK05326, potassium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215608 PLN03159, PLN03159, cation/H(+) antiporter 15; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217813 pfam03956, DUF340, Membrane protein of unknown function (DUF340) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213773 TIGR03082, Gneg_AbrB_dup, membrane protein AbrB duplication | Back alignment and domain information |
|---|
| >gnl|CDD|233189 TIGR00924, yjdL_sub1_fam, amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1207 | |||
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 100.0 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 100.0 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 100.0 | |
| COG0475 | 397 | KefB Kef-type K+ transport systems, membrane compo | 100.0 | |
| PLN03159 | 832 | cation/H(+) antiporter 15; Provisional | 100.0 | |
| COG4651 | 408 | RosB Kef-type K+ transport system, predicted NAD-b | 100.0 | |
| PRK05326 | 562 | potassium/proton antiporter; Reviewed | 100.0 | |
| PF00999 | 380 | Na_H_Exchanger: Sodium/hydrogen exchanger family; | 100.0 | |
| TIGR00932 | 273 | 2a37 transporter, monovalent cation:proton antipor | 100.0 | |
| TIGR00844 | 810 | c_cpa1 na(+)/h(+) antiporter. This model is specif | 99.98 | |
| KOG1650 | 769 | consensus Predicted K+/H+-antiporter [Inorganic io | 99.97 | |
| TIGR00831 | 525 | a_cpa1 Na+/H+ antiporter, bacterial form. This mod | 99.96 | |
| COG0025 | 429 | NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorg | 99.96 | |
| COG3263 | 574 | NhaP-type Na+/H+ and K+/H+ antiporters with a uniq | 99.96 | |
| TIGR00840 | 559 | b_cpa1 sodium/hydrogen exchanger 3. This model is | 99.94 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.89 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 99.82 | |
| KOG1965 | 575 | consensus Sodium/hydrogen exchanger protein [Inorg | 99.81 | |
| KOG4505 | 467 | consensus Na+/H+ antiporter [Inorganic ion transpo | 99.68 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 99.66 | |
| PRK14853 | 423 | nhaA pH-dependent sodium/proton antiporter; Provis | 99.65 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 99.57 | |
| COG1226 | 212 | Kch Kef-type K+ transport systems, predicted NAD-b | 99.57 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 99.48 | |
| TIGR00773 | 373 | NhaA Na+/H+ antiporter NhaA. These proteins are me | 99.36 | |
| KOG1966 | 670 | consensus Sodium/hydrogen exchanger protein [Inorg | 99.33 | |
| PRK14856 | 438 | nhaA pH-dependent sodium/proton antiporter; Provis | 99.24 | |
| PRK14854 | 383 | nhaA pH-dependent sodium/proton antiporter; Provis | 99.09 | |
| PRK14855 | 423 | nhaA pH-dependent sodium/proton antiporter; Provis | 99.08 | |
| PRK09560 | 389 | nhaA pH-dependent sodium/proton antiporter; Review | 99.08 | |
| PRK09561 | 388 | nhaA pH-dependent sodium/proton antiporter; Review | 99.06 | |
| PF06965 | 378 | Na_H_antiport_1: Na+/H+ antiporter 1; InterPro: IP | 98.99 | |
| COG3004 | 390 | NhaA Na+/H+ antiporter [Inorganic ion transport an | 98.97 | |
| PRK12460 | 312 | 2-keto-3-deoxygluconate permease; Provisional | 98.08 | |
| PF03812 | 314 | KdgT: 2-keto-3-deoxygluconate permease; InterPro: | 98.02 | |
| PF05684 | 378 | DUF819: Protein of unknown function (DUF819); Inte | 98.02 | |
| PF03616 | 368 | Glt_symporter: Sodium/glutamate symporter; InterPr | 97.74 | |
| TIGR00210 | 398 | gltS sodium--glutamate symport carrier (gltS). | 97.61 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.53 | |
| TIGR00698 | 335 | conserved hypothetical integral membrane protein. | 97.48 | |
| COG0786 | 404 | GltS Na+/glutamate symporter [Amino acid transport | 97.46 | |
| PF03601 | 305 | Cons_hypoth698: Conserved hypothetical protein 698 | 97.42 | |
| COG3180 | 352 | AbrB Putative ammonia monooxygenase [General funct | 97.41 | |
| PF05145 | 318 | AmoA: Putative ammonia monooxygenase; InterPro: IP | 97.16 | |
| TIGR00793 | 314 | kdgT 2-keto-3-deoxygluconate transporter. This fam | 97.06 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 96.96 | |
| PF13593 | 313 | DUF4137: SBF-like CPA transporter family (DUF4137) | 96.88 | |
| COG2855 | 334 | Predicted membrane protein [Function unknown] | 96.87 | |
| COG0385 | 319 | Predicted Na+-dependent transporter [General funct | 96.8 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 96.7 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 96.56 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 96.55 | |
| TIGR00832 | 328 | acr3 arsenical-resistance protein. The first prote | 96.51 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 96.47 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 96.43 | |
| TIGR00841 | 286 | bass bile acid transporter. Functionally character | 96.4 | |
| COG0679 | 311 | Predicted permeases [General function prediction o | 96.38 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 96.32 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 96.24 | |
| COG0798 | 342 | ACR3 Arsenite efflux pump ACR3 and related permeas | 96.22 | |
| PF03601 | 305 | Cons_hypoth698: Conserved hypothetical protein 698 | 95.97 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 95.96 | |
| TIGR00932 | 273 | 2a37 transporter, monovalent cation:proton antipor | 95.93 | |
| PRK05274 | 326 | 2-keto-3-deoxygluconate permease; Provisional | 95.75 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 95.73 | |
| PF03956 | 191 | DUF340: Membrane protein of unknown function (DUF3 | 95.7 | |
| PLN03159 | 832 | cation/H(+) antiporter 15; Provisional | 95.65 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 95.61 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 95.56 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 95.49 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 95.47 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 95.3 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 95.27 | |
| PRK03818 | 552 | putative transporter; Validated | 95.25 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 95.24 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 95.23 | |
| COG3493 | 438 | CitS Na+/citrate symporter [Energy production and | 95.18 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 95.06 | |
| COG2855 | 334 | Predicted membrane protein [Function unknown] | 94.92 | |
| TIGR03082 | 156 | Gneg_AbrB_dup membrane protein AbrB duplication. T | 94.91 | |
| COG0475 | 397 | KefB Kef-type K+ transport systems, membrane compo | 94.8 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 94.8 | |
| TIGR00698 | 335 | conserved hypothetical integral membrane protein. | 94.68 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.67 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.58 | |
| TIGR00844 | 810 | c_cpa1 na(+)/h(+) antiporter. This model is specif | 94.56 | |
| PLN02494 | 477 | adenosylhomocysteinase | 94.56 | |
| TIGR00946 | 321 | 2a69 he Auxin Efflux Carrier (AEC) Family. | 94.56 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 94.55 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 94.51 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 94.44 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 94.34 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 94.34 | |
| TIGR00831 | 525 | a_cpa1 Na+/H+ antiporter, bacterial form. This mod | 94.29 | |
| PRK05326 | 562 | potassium/proton antiporter; Reviewed | 94.26 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 94.26 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 94.23 | |
| PRK04972 | 558 | putative transporter; Provisional | 94.21 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 94.09 | |
| TIGR03082 | 156 | Gneg_AbrB_dup membrane protein AbrB duplication. T | 94.07 | |
| PF03390 | 414 | 2HCT: 2-hydroxycarboxylate transporter family; Int | 94.07 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 94.0 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 93.92 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 93.92 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 93.9 | |
| TIGR00783 | 347 | ccs citrate carrier protein, CCS family. These pro | 93.89 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 93.8 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 93.78 | |
| PF06826 | 169 | Asp-Al_Ex: Predicted Permease Membrane Region; Int | 93.71 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 93.66 | |
| PF03977 | 360 | OAD_beta: Na+-transporting oxaloacetate decarboxyl | 93.66 | |
| COG1023 | 300 | Gnd Predicted 6-phosphogluconate dehydrogenase [Ca | 93.62 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 93.59 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 93.59 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 93.57 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 93.57 | |
| TIGR00210 | 398 | gltS sodium--glutamate symport carrier (gltS). | 93.56 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 93.47 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 93.33 | |
| TIGR03136 | 399 | malonate_biotin Na+-transporting malonate decarbox | 93.22 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 93.21 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 93.19 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 93.13 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 93.12 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 93.07 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 93.06 | |
| PF01758 | 187 | SBF: Sodium Bile acid symporter family; InterPro: | 92.93 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 92.86 | |
| PF05145 | 318 | AmoA: Putative ammonia monooxygenase; InterPro: IP | 92.79 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 92.77 | |
| TIGR01625 | 154 | YidE_YbjL_dupl AspT/YidE/YbjL antiporter duplicati | 92.76 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 92.71 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 92.65 | |
| PRK03818 | 552 | putative transporter; Validated | 92.59 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 92.56 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 92.49 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.46 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 92.44 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 92.42 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 92.34 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 92.33 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 92.27 | |
| PRK04972 | 558 | putative transporter; Provisional | 92.09 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 92.03 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 92.0 | |
| TIGR01109 | 354 | Na_pump_decarbB sodium ion-translocating decarboxy | 91.94 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.74 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 91.73 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 91.71 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.64 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 91.51 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 91.45 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 91.44 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 91.36 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 91.35 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 91.27 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 91.01 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 90.98 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 90.93 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 90.86 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 90.85 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 90.83 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 90.75 | |
| COG2985 | 544 | Predicted permease [General function prediction on | 90.73 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 90.68 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 90.68 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 90.68 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 90.68 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 90.55 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 90.44 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 90.44 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 90.39 | |
| TIGR00946 | 321 | 2a69 he Auxin Efflux Carrier (AEC) Family. | 90.34 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.34 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 90.25 | |
| PRK05225 | 487 | ketol-acid reductoisomerase; Validated | 90.21 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 90.12 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 90.11 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 90.08 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 90.05 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 89.94 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 89.79 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 89.78 | |
| PLN00106 | 323 | malate dehydrogenase | 89.74 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 89.74 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 89.72 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 89.52 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.1 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 88.99 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 88.98 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 88.9 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 88.84 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 88.78 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 88.77 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 88.76 | |
| COG2431 | 297 | Predicted membrane protein [Function unknown] | 88.72 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 88.62 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 88.57 | |
| PRK15477 | 433 | oxaloacetate decarboxylase subunit beta; Provision | 88.53 | |
| PF03616 | 368 | Glt_symporter: Sodium/glutamate symporter; InterPr | 88.49 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 88.47 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 88.22 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 88.13 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 88.12 | |
| COG4651 | 408 | RosB Kef-type K+ transport system, predicted NAD-b | 88.04 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 88.04 | |
| PF05982 | 327 | DUF897: Domain of unknown function (DUF897) ; Inte | 88.01 | |
| PRK15476 | 433 | oxaloacetate decarboxylase subunit beta; Provision | 87.98 | |
| PLN02256 | 304 | arogenate dehydrogenase | 87.88 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 87.87 | |
| PRK12460 | 312 | 2-keto-3-deoxygluconate permease; Provisional | 87.85 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 87.74 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 87.69 | |
| TIGR03025 | 445 | EPS_sugtrans exopolysaccharide biosynthesis polypr | 87.65 | |
| COG5374 | 192 | Uncharacterized conserved protein [Function unknow | 87.49 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 87.49 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 87.45 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 87.44 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 87.42 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.42 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 87.39 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 87.29 | |
| PLN02712 | 667 | arogenate dehydrogenase | 87.24 | |
| PRK15475 | 433 | oxaloacetate decarboxylase subunit beta; Provision | 87.22 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 87.19 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.05 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.98 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 86.92 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 86.89 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 86.75 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 86.71 | |
| PF03547 | 385 | Mem_trans: Membrane transport protein; InterPro: I | 86.62 | |
| COG3180 | 352 | AbrB Putative ammonia monooxygenase [General funct | 86.53 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.47 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 86.44 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 86.43 | |
| TIGR00783 | 347 | ccs citrate carrier protein, CCS family. These pro | 86.42 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 86.37 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 86.35 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 86.34 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 86.3 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 86.27 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 86.21 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 86.16 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 85.93 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 85.86 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.74 | |
| PRK06019 | 372 | phosphoribosylaminoimidazole carboxylase ATPase su | 85.72 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 85.71 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.7 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 85.53 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 85.49 | |
| COG1346 | 230 | LrgB Putative effector of murein hydrolase [Cell e | 85.49 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 85.38 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 85.01 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 85.0 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 84.99 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 84.96 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 84.81 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 84.76 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 84.73 | |
| TIGR01142 | 380 | purT phosphoribosylglycinamide formyltransferase 2 | 84.7 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 84.67 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 84.61 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 84.58 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 84.54 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 84.41 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 84.41 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 84.3 | |
| PRK09903 | 314 | putative transporter YfdV; Provisional | 84.29 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 84.28 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 84.27 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 84.27 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 84.26 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 84.05 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 84.01 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 83.96 | |
| PRK08223 | 287 | hypothetical protein; Validated | 83.95 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 83.93 | |
| PLN02712 | 667 | arogenate dehydrogenase | 83.84 | |
| COG0786 | 404 | GltS Na+/glutamate symporter [Amino acid transport | 83.81 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 83.81 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 83.76 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 83.57 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 83.54 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 83.49 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 83.41 | |
| PLN02602 | 350 | lactate dehydrogenase | 83.41 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 83.38 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 83.29 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 83.23 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 83.22 | |
| KOG1370 | 434 | consensus S-adenosylhomocysteine hydrolase [Coenzy | 83.19 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 83.09 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 83.09 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 83.02 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 82.99 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 82.83 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 82.81 | |
| COG0025 | 429 | NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorg | 82.79 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 82.76 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 82.75 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 82.73 | |
| COG5420 | 71 | Uncharacterized conserved small protein containing | 82.69 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 82.65 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 82.61 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 82.53 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 82.37 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 82.27 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 82.26 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 82.13 | |
| PF00999 | 380 | Na_H_Exchanger: Sodium/hydrogen exchanger family; | 82.13 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 82.12 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 82.08 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 82.01 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 82.0 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 81.96 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 81.93 | |
| KOG1650 | 769 | consensus Predicted K+/H+-antiporter [Inorganic io | 81.91 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 81.87 | |
| PF13514 | 1111 | AAA_27: AAA domain | 81.79 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 81.71 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 81.71 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 81.66 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 81.63 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 81.62 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 81.45 | |
| TIGR03023 | 451 | WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp | 81.42 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 81.31 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 81.31 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 81.26 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 81.06 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 81.01 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 80.97 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 80.85 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 80.77 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 80.75 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 80.67 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 80.65 | |
| PLN02928 | 347 | oxidoreductase family protein | 80.44 | |
| COG5505 | 384 | Predicted integral membrane protein [Function unkn | 80.44 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 80.43 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 80.42 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 80.37 | |
| TIGR01082 | 448 | murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a | 80.34 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 80.31 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 80.28 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 80.26 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 80.11 | |
| PF03956 | 191 | DUF340: Membrane protein of unknown function (DUF3 | 80.01 |
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-79 Score=753.85 Aligned_cols=556 Identities=38% Similarity=0.599 Sum_probs=502.8
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHhhcccccccccCchhHHHHHHHHHHHHHHHHhhccChhHHHhc
Q 000965 601 ASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSM 680 (1207)
Q Consensus 601 ~~Ll~l~lLLl~A~ll~~L~~Rl~~lP~IVGyLLaGILLGP~gLglI~~~~~l~~LaeLGLv~LLF~aGLEldl~~Lr~~ 680 (1207)
.+++.+++++.++.+++++++|+ ++|+++|||++|+++||+++|++++.+.+..++++|++++||.+|+|+|++++|+.
T Consensus 5 ~~l~~~~~~l~~a~i~~~l~~rl-~lp~vlgyilaGillGP~~lg~i~~~~~i~~laelGvv~LlF~iGLEl~~~~l~~~ 83 (621)
T PRK03562 5 HTLIQALIYLGAAVLIVPIAVRL-GLGSVLGYLIAGCIIGPWGLRLVTDVESILHFAEFGVVLMLFVIGLELDPQRLWKL 83 (621)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHh-CCChHHHHHHHHHHhCcccccCCCCHHHHHHHHHHHHHHHHHHHHhCcCHHHHHHH
Confidence 57889999999999999999999 99999999999999999999999888889999999999999999999999999999
Q ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHhCCChHHHHHHhhccccCcHHHHHHHHHhcCCCCChhhHHHHHHHhhhhHHHHH
Q 000965 681 KKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVV 760 (1207)
Q Consensus 681 ~k~il~Lg~l~vllt~vlvglll~~llGls~~~ALlLGailS~TStAVVl~IL~elg~l~s~~Grl~Lsvsl~nDi~aIv 760 (1207)
++.++.+|..++++++++++. +.+++|++|..++++|.+++.|||++++++|+|++.+++++|+.+++++++||+++++
T Consensus 84 ~~~~~~~g~~qv~~~~~~~~~-~~~~~g~~~~~al~ig~~la~SStaiv~~~L~e~~~l~t~~G~~~l~~ll~~Dl~~i~ 162 (621)
T PRK03562 84 RRSIFGGGALQMVACGGLLGL-FCMLLGLRWQVALLIGLGLALSSTAIAMQAMNERNLMVTQMGRSAFAILLFQDIAAIP 162 (621)
T ss_pred HHHHHHHHHHHHHHHHHHHHH-HHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccccCchHHHHHHHHHHHHHHHHH
Confidence 999999999999998875554 4456799999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHHHHHHH
Q 000965 761 LLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTA 840 (1207)
Q Consensus 761 ll~li~~la~~~s~g~~~~~~i~~~L~~~ll~~il~iil~lllg~~llrpll~~ia~~~s~elf~l~~Lal~Lg~a~Lae 840 (1207)
++++++.++.... ..+.. .++..+++.++++++++++++|+.+|+++|+.+.+++|.++..+++++++++++++
T Consensus 163 ll~l~~~l~~~~~--~~~~~----~~~~~~~~~~~~~~~~~~~g~~l~~~l~~~~~~~~~~e~~~~~~l~lv~~~a~la~ 236 (621)
T PRK03562 163 LVAMIPLLAASGA--STTLG----AFALSALKVAGALALVVLGGRYVTRPALRFVARSGLREVFTAVALFLVFGFGLLME 236 (621)
T ss_pred HHHHHHHHccCCC--ccchh----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHHHH
Confidence 9988877654211 11111 12223334455556667778999999999999888899999888999999999999
Q ss_pred HhcchHHHHHHHHHHhhcccchhHHHHHHHHhHHhHHHHHHHHHHcCccChhhhccchhhHHHHHHHHHHHHHHHHHHHH
Q 000965 841 RAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVG 920 (1207)
Q Consensus 841 ~lGLS~~LGAFvAGLvLsn~~~~~~l~e~l~~~~~~flplFFv~IGm~Idl~~L~~~~~~illlllllll~K~l~v~l~~ 920 (1207)
.+|+|+++|||+||+++++++++|+++++++||+++|+|+||+++||++|+..+..+|+.++.++++.+++|++++++.+
T Consensus 237 ~~Gls~~lGAFlAGl~l~~~~~~~~le~~i~pf~~lll~lFFi~vG~~id~~~l~~~~~~il~~~~~~~~~K~~~~~~~~ 316 (621)
T PRK03562 237 EVGLSMALGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIAVGMSIDFGTLLENPLRILILLLGFLAIKIAMLWLLA 316 (621)
T ss_pred HhCccHHHHHHHHHHHhcCCccHHHHHHHHHHHHHHHHHHHHHHhhhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999998877776666667778899999999999
Q ss_pred HhhCcchhhhhhhhhhcCCCcchhhHHHHHHHhhccchhhhHHHHHHHHHHHHHhHHHHHhhhhhhh-hhhhcccccccC
Q 000965 921 RLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIA-SRFEQHDVRSLL 999 (1207)
Q Consensus 921 ~l~g~~~real~lGL~La~rGe~alVLa~lal~~glIs~el~siLvlvvvlS~lItPlL~~~~~~La-~rl~~~~~~~~~ 999 (1207)
+++|+++++++.+|+.|+|+|+|+++++..+.+.++++++.++++++++++||+++|++..+.+++. .|+....
T Consensus 317 ~~~g~~~~~a~~~gl~L~~~Gef~~vl~~~a~~~~~i~~~~~~~lv~~v~lS~~~tP~l~~~~~~~~~~~~~~~~----- 391 (621)
T PRK03562 317 RPLGVPRKQRRWFAVLLGQGGEFAFVVFGAAQMANVLEPEWAKLLTLAVALSMAATPLLLVLLDRLEQSRTEEAR----- 391 (621)
T ss_pred HHhCCCHhHHHHHHHHHhccccHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHhhhcc-----
Confidence 9999999999999999999999999999999999999999999999999999999999988754443 3332111
Q ss_pred ccccccccccccccccCCCchHHHHHHHHHhcCCCeEeecCChHHHHhhhhCCCCEEEecCCCHHHHHhcCccccCEEEE
Q 000965 1000 PVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAI 1079 (1207)
Q Consensus 1000 ~~e~~~~~lk~hVIIiG~GrvG~~Ia~~L~~~gi~vvVID~D~e~ve~~r~~g~~vi~GDatd~evL~~AgI~~A~~VVi 1079 (1207)
.+...++.++|+||||||++|+.+++.|++.|+++++||.|+++++.+++.|+++++||++|+++|+++|+++|+.+|+
T Consensus 392 -~~~~~~~~~~~vII~G~Gr~G~~va~~L~~~g~~vvvID~d~~~v~~~~~~g~~v~~GDat~~~~L~~agi~~A~~vvv 470 (621)
T PRK03562 392 -EADEIDEQQPRVIIAGFGRFGQIVGRLLLSSGVKMTVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLIN 470 (621)
T ss_pred -cccccccccCcEEEEecChHHHHHHHHHHhCCCCEEEEECCHHHHHHHHhcCCeEEEEeCCCHHHHHhcCCCcCCEEEE
Confidence 1112234579999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecCCcchhHHHHHHHHHhCCCceEEEeeCChHHHHHHHhCCCCeeecCCcHHHHHHHHHHHHHcCCCHHHHHHHHHHHHH
Q 000965 1080 TLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPASEIAATINEFRT 1159 (1207)
Q Consensus 1080 atddd~~Ni~i~l~aR~l~P~i~IIaRa~d~~~~~~L~~aGAd~VI~p~~eaal~La~~iL~~lg~~~~ei~~~i~~~r~ 1159 (1207)
+++||+.|..++..+|++||+++|++|++|+++.++|+++|||+|+++++++++.++++++..+|.+++++.+.++.+|+
T Consensus 471 ~~~d~~~n~~i~~~ar~~~p~~~iiaRa~d~~~~~~L~~~Gad~v~~e~~e~sl~l~~~~L~~lg~~~~~~~~~~~~~r~ 550 (621)
T PRK03562 471 AIDDPQTSLQLVELVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKSGRLVLESLGLGPYEARERADRFRR 550 (621)
T ss_pred EeCCHHHHHHHHHHHHHhCCCCeEEEEECCHHHHHHHHHCCCCEEehhhHhHHHHHHHHHHHHcCCCHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcHHHHHHHhh
Q 000965 1160 RHLSELTELCQ 1170 (1207)
Q Consensus 1160 ~~~~~L~~~~~ 1170 (1207)
++++.++....
T Consensus 551 ~~~~~~~~~~~ 561 (621)
T PRK03562 551 HNLQMVEEMAP 561 (621)
T ss_pred HHHHHHHHHhh
Confidence 99999977644
|
|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03159 cation/H(+) antiporter 15; Provisional | Back alignment and domain information |
|---|
| >COG4651 RosB Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05326 potassium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >PF00999 Na_H_Exchanger: Sodium/hydrogen exchanger family; InterPro: IPR006153 Sodium proton exchangers (NHEs) constitute a large family of integral membrane protein transporters that are responsible for the counter-transport of protons and sodium ions across lipid bilayers [, ] | Back alignment and domain information |
|---|
| >TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family | Back alignment and domain information |
|---|
| >TIGR00844 c_cpa1 na(+)/h(+) antiporter | Back alignment and domain information |
|---|
| >KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00831 a_cpa1 Na+/H+ antiporter, bacterial form | Back alignment and domain information |
|---|
| >COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00840 b_cpa1 sodium/hydrogen exchanger 3 | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >KOG1965 consensus Sodium/hydrogen exchanger protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4505 consensus Na+/H+ antiporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14853 nhaA pH-dependent sodium/proton antiporter; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00773 NhaA Na+/H+ antiporter NhaA | Back alignment and domain information |
|---|
| >KOG1966 consensus Sodium/hydrogen exchanger protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14856 nhaA pH-dependent sodium/proton antiporter; Provisional | Back alignment and domain information |
|---|
| >PRK14854 nhaA pH-dependent sodium/proton antiporter; Provisional | Back alignment and domain information |
|---|
| >PRK14855 nhaA pH-dependent sodium/proton antiporter; Provisional | Back alignment and domain information |
|---|
| >PRK09560 nhaA pH-dependent sodium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >PRK09561 nhaA pH-dependent sodium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >PF06965 Na_H_antiport_1: Na+/H+ antiporter 1; InterPro: IPR004670 NhaA is a sodium ion/proton antiporter that uses the proton electrochemical gradient to expel sodium ions from the cytoplasm and functions primarily in the adaptation to high salinity at alkaline pH | Back alignment and domain information |
|---|
| >COG3004 NhaA Na+/H+ antiporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12460 2-keto-3-deoxygluconate permease; Provisional | Back alignment and domain information |
|---|
| >PF03812 KdgT: 2-keto-3-deoxygluconate permease; InterPro: IPR004684 This family includes the characterised 2-Keto-3-Deoxygluconate transporters from Bacillus subtilis and Erwinia chrysanthemi | Back alignment and domain information |
|---|
| >PF05684 DUF819: Protein of unknown function (DUF819); InterPro: IPR008537 This family contains proteins of unknown function from archaeal, bacterial and plant species | Back alignment and domain information |
|---|
| >PF03616 Glt_symporter: Sodium/glutamate symporter; InterPro: IPR004445 This is a family of sodium/glutamate symporters (glutamate permeases), which catalyse the sodium-dependent uptake of extracellular glutamate | Back alignment and domain information |
|---|
| >TIGR00210 gltS sodium--glutamate symport carrier (gltS) | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00698 conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03601 Cons_hypoth698: Conserved hypothetical protein 698; InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins | Back alignment and domain information |
|---|
| >COG3180 AbrB Putative ammonia monooxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05145 AmoA: Putative ammonia monooxygenase; InterPro: IPR007820 This family contains sequences annotated as ammonia monooxygenase | Back alignment and domain information |
|---|
| >TIGR00793 kdgT 2-keto-3-deoxygluconate transporter | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF13593 DUF4137: SBF-like CPA transporter family (DUF4137) | Back alignment and domain information |
|---|
| >COG2855 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0385 Predicted Na+-dependent transporter [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >TIGR00832 acr3 arsenical-resistance protein | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >TIGR00841 bass bile acid transporter | Back alignment and domain information |
|---|
| >COG0679 Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0798 ACR3 Arsenite efflux pump ACR3 and related permeases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03601 Cons_hypoth698: Conserved hypothetical protein 698; InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family | Back alignment and domain information |
|---|
| >PRK05274 2-keto-3-deoxygluconate permease; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PF03956 DUF340: Membrane protein of unknown function (DUF340); InterPro: IPR005642 Members of this family contain a conserved core of four predicted transmembrane segments | Back alignment and domain information |
|---|
| >PLN03159 cation/H(+) antiporter 15; Provisional | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >COG3493 CitS Na+/citrate symporter [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >COG2855 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03082 Gneg_AbrB_dup membrane protein AbrB duplication | Back alignment and domain information |
|---|
| >COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00698 conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR00844 c_cpa1 na(+)/h(+) antiporter | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >TIGR00946 2a69 he Auxin Efflux Carrier (AEC) Family | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00831 a_cpa1 Na+/H+ antiporter, bacterial form | Back alignment and domain information |
|---|
| >PRK05326 potassium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04972 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03082 Gneg_AbrB_dup membrane protein AbrB duplication | Back alignment and domain information |
|---|
| >PF03390 2HCT: 2-hydroxycarboxylate transporter family; InterPro: IPR004679 The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >TIGR00783 ccs citrate carrier protein, CCS family | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PF06826 Asp-Al_Ex: Predicted Permease Membrane Region; InterPro: IPR006512 These sequences contain a domain that is duplicated in HI0035 of Haemophilus influenzae, in YidE and YbjL of Escherichia coli, and in a number of other putative transporters | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PF03977 OAD_beta: Na+-transporting oxaloacetate decarboxylase beta subunit; InterPro: IPR005661 Members of this family are integral membrane proteins | Back alignment and domain information |
|---|
| >COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >TIGR00210 gltS sodium--glutamate symport carrier (gltS) | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03136 malonate_biotin Na+-transporting malonate decarboxylase, carboxybiotin decarboxylase subunit | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF01758 SBF: Sodium Bile acid symporter family; InterPro: IPR002657 This family of proteins are found both in prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF05145 AmoA: Putative ammonia monooxygenase; InterPro: IPR007820 This family contains sequences annotated as ammonia monooxygenase | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01625 YidE_YbjL_dupl AspT/YidE/YbjL antiporter duplication domain | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04972 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01109 Na_pump_decarbB sodium ion-translocating decarboxylase, beta subunit | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >COG2985 Predicted permease [General function prediction only] | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR00946 2a69 he Auxin Efflux Carrier (AEC) Family | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK05225 ketol-acid reductoisomerase; Validated | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >COG2431 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15477 oxaloacetate decarboxylase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF03616 Glt_symporter: Sodium/glutamate symporter; InterPro: IPR004445 This is a family of sodium/glutamate symporters (glutamate permeases), which catalyse the sodium-dependent uptake of extracellular glutamate | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >COG4651 RosB Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05982 DUF897: Domain of unknown function (DUF897) ; InterPro: IPR010293 This is a family of bacterial proteins with unknown function | Back alignment and domain information |
|---|
| >PRK15476 oxaloacetate decarboxylase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK12460 2-keto-3-deoxygluconate permease; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >COG5374 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK15475 oxaloacetate decarboxylase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF03547 Mem_trans: Membrane transport protein; InterPro: IPR004776 This entry represents a mostly uncharacterised family of membrane transport proteins found in eukaryotes, bacteria and archaea | Back alignment and domain information |
|---|
| >COG3180 AbrB Putative ammonia monooxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >TIGR00783 ccs citrate carrier protein, CCS family | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1346 LrgB Putative effector of murein hydrolase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09903 putative transporter YfdV; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >COG5420 Uncharacterized conserved small protein containing a coiled-coil domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PF00999 Na_H_Exchanger: Sodium/hydrogen exchanger family; InterPro: IPR006153 Sodium proton exchangers (NHEs) constitute a large family of integral membrane protein transporters that are responsible for the counter-transport of protons and sodium ions across lipid bilayers [, ] | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >COG5505 Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01082 murC UDP-N-acetylmuramate--alanine ligase | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03956 DUF340: Membrane protein of unknown function (DUF340); InterPro: IPR005642 Members of this family contain a conserved core of four predicted transmembrane segments | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1207 | ||||
| 3eyw_A | 413 | Crystal Structure Of The C-terminal Domain Of E. Co | 2e-13 | ||
| 3fwz_A | 140 | Crystal Structure Of Trka-n Domain Of Inner Membran | 5e-04 |
| >pdb|3EYW|A Chain A, Crystal Structure Of The C-terminal Domain Of E. Coli Kefc In Complex With Keff Length = 413 | Back alignment and structure |
|
| >pdb|3FWZ|A Chain A, Crystal Structure Of Trka-n Domain Of Inner Membrane Protein Ybal From Escherichia Coli Length = 140 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Length = 413 | Back alignment and structure |
|---|
Score = 195 bits (497), Expect = 1e-54
Identities = 46/170 (27%), Positives = 76/170 (44%)
Query: 1009 QDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHK 1068
+I+ GFGR GQI +LL + V LD D + R + V++GDA ++L
Sbjct: 4 GMRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES 63
Query: 1069 VGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPET 1128
GA +A +D P N + + ++FP+++ RA D+DH + L +AG ET
Sbjct: 64 AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERET 123
Query: 1129 LEPSLQLAAAVLAQAKLPASEIAATINEFRTRHLSELTELCQASGSSLGY 1178
E +L+ L L E + FR ++ + E+ +
Sbjct: 124 FEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKAR 173
|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Length = 140 | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Length = 183 | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141 | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Length = 726 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Length = 155 | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} Length = 798 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Length = 140 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1207 | |||
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 99.91 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 99.87 | |
| 1zcd_A | 388 | Na(+)/H(+) antiporter 1; membrane protein; 3.45A { | 99.82 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.82 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.78 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 99.77 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 99.76 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 99.74 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 99.73 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 99.7 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.68 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 99.67 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 99.56 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 99.52 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 99.51 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 99.49 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 99.31 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 99.25 | |
| 4hpf_A | 722 | Potassium channel subfamily U member 1; PH-gated, | 98.84 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.71 | |
| 3zux_A | 332 | Transporter, ASBTNM; transport protein, membrane p | 97.69 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.86 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.39 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 95.94 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 95.65 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 95.54 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 95.49 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 95.41 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 95.32 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 95.31 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 95.29 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 95.25 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 95.22 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 95.21 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 95.2 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 95.19 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 95.18 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 95.17 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 95.15 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 95.13 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 95.12 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 95.03 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 94.99 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 94.93 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 94.92 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 94.9 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 94.89 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 94.82 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 94.8 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 94.73 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 94.72 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 94.72 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 94.68 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 94.68 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 94.67 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 94.61 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 94.56 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 94.54 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 94.46 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 94.45 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 94.44 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 94.41 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 94.4 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.34 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 94.32 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.31 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 94.29 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.24 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 94.22 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 94.19 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 94.15 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 94.09 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 94.07 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 93.97 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.9 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 93.67 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 93.63 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 93.58 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 93.56 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 93.54 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 93.53 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.52 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 93.51 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 93.45 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 93.42 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 93.42 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 93.35 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 93.23 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 93.22 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 93.2 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 93.11 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 93.08 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 92.95 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 92.89 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 92.89 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 92.83 | |
| 2akf_A | 32 | Coronin-1A; coiled coil, protein binding; 1.20A {S | 92.78 | |
| 3on5_A | 362 | BH1974 protein; structural genomics, joint center | 92.72 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 92.67 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 92.51 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 92.48 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 92.43 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 92.36 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 92.25 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 92.24 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 92.16 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 92.1 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 92.08 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 91.96 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 91.91 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 91.85 | |
| 4hpf_A | 722 | Potassium channel subfamily U member 1; PH-gated, | 91.82 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 91.81 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 91.78 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 91.74 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 91.66 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 91.63 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 91.6 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 91.56 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 91.46 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 91.44 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 91.41 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 91.35 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 91.35 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 91.31 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 91.31 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 91.29 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 91.23 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 91.22 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 91.21 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 91.19 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 91.15 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 91.09 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 90.96 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 90.91 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 90.89 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 90.78 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 90.75 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 90.73 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 90.73 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 90.72 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 90.7 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 90.59 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 90.53 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 90.45 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 90.41 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 90.4 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 90.39 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 90.08 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 90.07 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 90.06 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 90.06 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 89.96 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 89.92 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 89.89 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 89.81 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 89.8 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 89.72 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 89.68 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 89.68 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 89.59 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 89.54 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 89.5 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 89.4 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 89.36 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 89.34 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 89.28 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 89.25 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 89.23 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 89.15 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 89.01 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 88.98 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 88.93 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 88.92 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 88.91 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 88.9 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 88.83 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 88.82 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 88.8 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 88.74 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 88.71 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 88.67 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 88.66 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 88.66 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 88.45 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 88.39 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 88.39 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 88.33 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 88.23 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 88.19 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 88.14 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 88.13 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 88.1 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 88.08 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 88.08 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 88.02 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 88.02 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 88.0 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 87.88 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 87.84 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 87.75 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 87.68 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 87.68 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 87.66 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 87.56 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 87.48 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 87.35 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 87.34 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 87.31 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 87.28 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 87.26 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 87.21 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 87.17 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 87.16 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 87.15 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 87.12 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 87.02 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 86.99 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 86.98 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 86.86 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 86.84 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 86.83 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 86.82 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 86.72 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 86.67 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 86.58 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 86.57 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 86.47 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 86.47 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 86.42 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 86.35 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 86.34 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 86.27 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 86.14 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 86.09 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 86.08 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 86.02 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 85.93 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 85.88 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 85.86 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 85.81 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 85.77 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 85.73 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 85.72 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 85.7 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 85.63 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 85.59 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 85.58 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 85.53 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 85.42 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 85.36 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 85.34 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 85.32 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 85.29 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 85.22 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 85.17 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 85.11 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 85.07 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 85.03 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 85.03 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 85.01 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 84.98 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 84.95 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 84.94 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 84.93 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 84.7 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 84.68 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 84.66 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 84.65 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 84.63 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 84.56 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 84.52 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 84.48 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 84.47 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 84.41 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 84.4 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 84.39 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 84.37 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 84.35 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 84.18 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 83.98 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 83.96 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 83.95 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 83.9 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 83.87 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 83.64 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 83.63 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 83.51 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 83.49 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 83.47 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 83.46 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 83.36 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 83.23 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 83.12 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 83.05 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 82.99 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 82.99 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 82.98 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 82.97 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 82.94 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 82.86 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 82.84 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 82.82 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 82.81 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 82.79 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 82.72 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 82.57 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 82.57 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 82.57 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 82.55 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 82.55 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 82.45 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 82.36 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 82.34 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 82.26 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 82.11 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 82.0 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 81.96 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 81.94 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 81.92 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 81.8 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 81.72 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 81.71 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 81.6 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 81.56 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 81.55 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 81.55 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 81.49 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 81.4 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 81.4 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 81.28 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 81.25 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 81.21 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 81.15 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 81.1 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 81.1 | |
| 3zux_A | 332 | Transporter, ASBTNM; transport protein, membrane p | 81.08 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 81.06 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 81.01 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 80.99 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 80.84 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 80.76 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 80.72 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 80.65 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 80.63 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 80.58 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 80.58 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 80.53 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 80.52 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 80.45 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 80.39 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 80.34 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 80.28 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 80.21 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 80.17 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 80.15 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 80.14 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 80.12 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 80.11 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 81.21 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 80.03 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 80.02 |
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
Probab=99.91 E-value=3.6e-24 Score=251.07 Aligned_cols=163 Identities=28% Similarity=0.453 Sum_probs=159.0
Q ss_pred cccccccCCCchHHHHHHHHHhcCCCeEeecCChHHHHhhhhCCCCEEEecCCCHHHHHhcCccccCEEEEecCCcchhH
Q 000965 1009 QDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANY 1088 (1207)
Q Consensus 1009 k~hVIIiG~GrvG~~Ia~~L~~~gi~vvVID~D~e~ve~~r~~g~~vi~GDatd~evL~~AgI~~A~~VViatddd~~Ni 1088 (1207)
+.||||||+|++|+.+++.|.+.|++|++||.|+++++.++..|+++++||++++++|+++|+++|++||+++++++.|+
T Consensus 4 ~~~viIiG~Gr~G~~va~~L~~~g~~vvvId~d~~~v~~~~~~g~~vi~GDat~~~~L~~agi~~A~~viv~~~~~~~n~ 83 (413)
T 3l9w_A 4 GMRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNL 83 (413)
T ss_dssp CCSEEEECCSHHHHHHHHHHHHTTCCEEEEECCHHHHHHHHHTTCCCEESCTTCHHHHHHTTTTTCSEEEECCSSHHHHH
T ss_pred CCeEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHhCCCeEEEcCCCCHHHHHhcCCCccCEEEECCCChHHHH
Confidence 46999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhCCCceEEEeeCChHHHHHHHhCCCCeeecCCcHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhcHHHHHHH
Q 000965 1089 RTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPASEIAATINEFRTRHLSELTEL 1168 (1207)
Q Consensus 1089 ~i~l~aR~l~P~i~IIaRa~d~~~~~~L~~aGAd~VI~p~~eaal~La~~iL~~lg~~~~ei~~~i~~~r~~~~~~L~~~ 1168 (1207)
.++..+|+++|+++||||++++++...|+++|||+||+|++++|+.|++++|..+|++++++.+.++.+|+++++.++..
T Consensus 84 ~i~~~ar~~~p~~~Iiara~~~~~~~~L~~~Gad~Vi~~~~~~a~~la~~~L~~lg~~~~~~~~~~~~~r~~~~~~~~~~ 163 (413)
T 3l9w_A 84 QLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEM 163 (413)
T ss_dssp HHHHHHHHHCTTCEEEEEESSHHHHHHHHHTTCSSCEETTHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHhCCCCeEEEEECCHHHHHHHHHCCCCEEECccHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999887
Q ss_pred hhh
Q 000965 1169 CQA 1171 (1207)
Q Consensus 1169 ~~~ 1171 (1207)
...
T Consensus 164 ~~~ 166 (413)
T 3l9w_A 164 AMV 166 (413)
T ss_dssp HHC
T ss_pred hhc
Confidence 554
|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1zcd_A Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_A | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A | Back alignment and structure |
|---|
| >4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3zux_A Transporter, ASBTNM; transport protein, membrane protein; HET: TCH LDA PTY; 2.20A {Neisseria meningitidis} PDB: 3zuy_A* | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >2akf_A Coronin-1A; coiled coil, protein binding; 1.20A {Synthetic} | Back alignment and structure |
|---|
| >3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3zux_A Transporter, ASBTNM; transport protein, membrane protein; HET: TCH LDA PTY; 2.20A {Neisseria meningitidis} PDB: 3zuy_A* | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1207 | ||||
| d2fy8a1 | 129 | c.2.1.9 (A:116-244) Potassium channel-related prot | 3e-19 | |
| d1id1a_ | 153 | c.2.1.9 (A:) Rck domain from putative potassium ch | 4e-18 | |
| d2hmva1 | 134 | c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T | 3e-16 | |
| d1lssa_ | 132 | c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus ja | 6e-13 |
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Potassium channel NAD-binding domain domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 83.0 bits (204), Expect = 3e-19
Identities = 19/129 (14%), Positives = 42/129 (32%), Gaps = 2/129 (1%)
Query: 1011 HIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVG 1070
H+++CG+ + L + + + GD L K
Sbjct: 2 HVVICGWSESTLECLRELRGSEVFVL--AEDENVRKKVLRSGANFVHGDPTRVSDLEKAN 59
Query: 1071 AERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLE 1130
A A + L++ + + K +V+ A ++ L AGA V+ +
Sbjct: 60 VRGARAVIVNLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVI 119
Query: 1131 PSLQLAAAV 1139
++ ++
Sbjct: 120 SGRLMSRSI 128
|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 132 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1207 | |||
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 99.87 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 99.86 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 99.86 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 99.84 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 97.22 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.87 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.83 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 96.7 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 96.52 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 96.27 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 96.18 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 96.01 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 95.59 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.55 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 95.17 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 95.05 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 95.0 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 94.75 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 94.61 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 94.5 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 94.49 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 94.16 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 94.07 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 93.89 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 93.1 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 92.82 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 92.81 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 92.77 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 92.22 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 92.18 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 92.07 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 92.02 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 91.98 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 91.73 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 91.46 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 91.36 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 91.34 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 91.24 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 90.91 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 90.81 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 90.79 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 90.18 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 90.17 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 90.12 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 90.1 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 89.96 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.84 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 89.74 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 89.73 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 89.7 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 89.69 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 89.63 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 89.59 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 89.58 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 89.51 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 89.43 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 89.2 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 88.95 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 88.89 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 88.7 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 88.67 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 88.49 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 88.26 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 88.24 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 88.22 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 87.87 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 87.81 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 87.7 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 87.44 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 87.26 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 87.2 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 87.16 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 87.16 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 87.14 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 86.8 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 86.2 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 86.06 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 86.03 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 86.0 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 85.54 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 85.3 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 85.03 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 85.03 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 85.01 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 84.88 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 84.86 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 84.86 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 84.64 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 84.42 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 84.36 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 84.23 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 84.21 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 84.1 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 84.02 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 83.86 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 83.85 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 83.71 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 83.7 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 83.52 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 83.49 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 83.45 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 83.44 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 83.31 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 83.14 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 83.06 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 83.03 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 82.89 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 82.8 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 82.77 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 82.66 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 82.64 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 82.38 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 82.14 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 81.99 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 81.81 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 81.75 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 81.68 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 81.61 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 81.56 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 81.54 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 81.48 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 81.43 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 81.13 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 81.11 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 81.07 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 80.99 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 80.85 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 80.56 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 80.35 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 80.25 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 80.24 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 80.18 |
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Potassium channel NAD-binding domain domain: Rck domain from putative potassium channel Kch species: Escherichia coli [TaxId: 562]
Probab=99.87 E-value=4.3e-22 Score=199.76 Aligned_cols=142 Identities=19% Similarity=0.190 Sum_probs=129.0
Q ss_pred ccccccccCCCchHHHHHHHHHhcCCCeEeecCChHH----HHhhhhCCCCEEEecCCCHHHHHhcCccccCEEEEecCC
Q 000965 1008 LQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDR----VAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDT 1083 (1207)
Q Consensus 1008 lk~hVIIiG~GrvG~~Ia~~L~~~gi~vvVID~D~e~----ve~~r~~g~~vi~GDatd~evL~~AgI~~A~~VViatdd 1083 (1207)
.++|+||||||++|+.+++.|.+.|+++++||.|++. .+..+..|+.+++||++++++|+++|+++|+++|+++++
T Consensus 2 ~knHiII~G~g~~g~~l~~~L~~~~~~v~vId~d~~~~~~~~~~~~~~~~~vi~Gd~~d~~~L~~a~i~~a~~vi~~~~~ 81 (153)
T d1id1a_ 2 RKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDN 81 (153)
T ss_dssp CCSCEEEECCSHHHHHHHHHHHHTTCCEEEEECCCHHHHHHHHHHHCTTCEEEESCTTSHHHHHHHTTTTCSEEEECSSC
T ss_pred CCCEEEEECCCHHHHHHHHHHHHcCCCEEEEeccchhHHHHHHHhhcCCcEEEEccCcchHHHHHhccccCCEEEEcccc
Confidence 3689999999999999999999999999999999864 445566799999999999999999999999999999999
Q ss_pred cchhHHHHHHHHHhCCCceEEEeeCChHHHHHHHhCCCCeeecCCcHHHHHHHHHHHHHcCCCHHHH
Q 000965 1084 PGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPASEI 1150 (1207)
Q Consensus 1084 d~~Ni~i~l~aR~l~P~i~IIaRa~d~~~~~~L~~aGAd~VI~p~~eaal~La~~iL~~lg~~~~ei 1150 (1207)
|..|+.+++.+|+++|++++|++++++++...|+++|+|.||.|...++..+++.+. .-+++.+.+
T Consensus 82 d~~n~~~~~~~r~~~~~~~iia~~~~~~~~~~l~~~Gad~vi~p~~~~~~~l~~~l~-~~~v~~~~~ 147 (153)
T d1id1a_ 82 DADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPDIILSPQLFGSEILARVLN-GEEINNDML 147 (153)
T ss_dssp HHHHHHHHHHHHHHTSSSCEEEECSSGGGHHHHHTTCCSEEECHHHHHHHHHHHHHT-TCCCCHHHH
T ss_pred HHHHHHHHHHHHHhCCCCceEEEEcCHHHHHHHHHCCCCEEECHHHHHHHHHHHHhC-cCCCCHHHH
Confidence 999999999999999999999999999999999999999999999999988887654 345555443
|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|