Citrus Sinensis ID: 000981

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200--
MGGQQQHGGTRHSVVFAVNGEKFEVSSVDPSTTLLEFLRYHTRFKSVKLGCGEGGCGACVVLLSKYNPELDQLEDFTISSCLTLLCSVNGCLITTSEGLGNSKTGFHPIHQRFAGFHASQCGFCTPGMCMSLFSALVDAEKTHRPEPPPGLSKLTISEAEKAIAGNLCRCTGYRPIADACKSFAADVDIEDLGINSFWAKGESKEVKISRLPPYKHNGELCRFPLFLKKENSSAMLLDVKGSWHSPISVQELRNVLESVEGSNQISSKLVAGNTGMGYYKEVEHYDKYIDIRYIPELSVIRRDQTGIEIGATVTISKAIEALKEETKEFHSEALMVFKKIAGHMEKIASRFIRNSASVGGNLVMAQRKHFPSDVATVLLGAGAMVNIMTGQKCEKLMLEEFLERPPLDSRSILLSVEIPCWDLTRNVTSETNSVLLFETYRAAPRPLGNALPHLNAAFLAEVSPCKTGDGIRVNNCRLAFGAFGTKHAIRARRVEEFLTGKVLNFGVLYEAIKLLRDSVVPEDGTSIPAYRSSLAVGFLYEFFGSLTEMKNGISRDWLCGYSNNVSLKDSHVQQNHKQFDESKVPTLLSSAEQVVQLSREYYPVGEPITKSGAALQASGEAIYVDDIPSPINCLYGAFIYSTKPLARIKGIEFKSESVPDVVTALLSYKDIPEGGQNIGSKTIFGSEPLFADELTRCAGQPVAFVVADSQKNADRAADVAVVDYEMGNLEPPILSVEEAVDRSSLFEVPSFLYPKPVGDISKGMNEADHRILAAEIKLGSQYYFYMETQTALAVPDEDNCLVVYSSIQCPESAHATIARCLGIPEHNVRVITRRVGGAFGGKAIKAMPVATACALAAYKLCRPVRIYVKRKTDMIMVGGRHPMKITYSVGFKSNGKITALQLNILIDAGLSPDVSPIMPSNMIGALKKYDWGALHFDIKVCRTNLPSRSAMRAPGEVQGSFIAEAVIEHVASTLSMEVDFVRNINLHTHKSLNLFYESSAGEYAEYTLPLIWDKLAVSSSFNQRTEMIKEFNRSNLWRKKGVCRLPIVHEVTLRSTPGKVSILSDGSVVVEVGGIEMGQGLWTKVKQMAAFALSSIKCGGTGNLLEKVRVVQADTLSVIQGGFTAGSTTSEASCQVVRDCCNILVERLTLLRERLQGQMGNVEWETLIQQVHICSSEALSTEFILFNFVCQRTCTDYLSPSA
ccccccccccccEEEEEEccEEEEEccccccccHHHHHHccccccccccccccccccEEEEEEcccccccccEEEEEHHHHccccccccccEEEEEcccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEECccccEEEECccHHHHHHHHHHcccccccccEEEEccccccccccccccccEECcccccccccEEEcccCEEEcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHccccccccccccccccccccHHHHHHHcccEEEEEEcccEEEEEcccccccccccccEEEEEEEccccccccccccccccccEEEEcccccccccccHHHHcEEEEEEEcccccccccEEEEEEEEEccccccccccHHHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccCEEECccccccccccEEEEEEECccccEEEEEEEcccccccccEEEEEEccccccccccccccccccccEEEccccEEEcccEEEEEEEccHHHHHHHHcccEEEECccccccccccHHHHHHcccccccccccccccccccHHHHcccccEEEEEEEEEcEEEEEEEcccEEEEECcccccEEEEEccccHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHHHHcccccEEEECcHHHHHHHccccccEEEEEEEEEccccCEEEEEEEEEEccccccccccHHHHHHHccccccccccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccEEEEEEEEEEEEEcccccccCEEEECccccEEEEEccEEcccccHHHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccEECccccccccEEEEEEEECccccc
*************VVFAVNGEKFEVSSVDPSTTLLEFLRYHTRFKSVKLGCGEGGCGACVVLLSKYNPELDQLEDFTISSCLTLLCSVNGCLITTSEGLGNSKTGFHPIHQRFAGFHASQCGFCTPGMCMSLFSALVDA**************LTISEAEKAIAGNLCRCTGYRPIADACKSFAADVDIEDLGINSFWAKGESKEVKISRLPPYKHNGELCRFPLFLKKENSSAMLLDVKGSWHSPISVQELRNVLESVEGSNQISSKLVAGNTGMGYYKEVEHYDKYIDIRYIPELSVIRRDQTGIEIGATVTISKAIEALKEETKEFHSEALMVFKKIAGHMEKIASRFIRNSASVGGNLVMAQRKHFPSDVATVLLGAGAMVNIMTGQKCEKLMLEEFLERPPLDSRSILLSVEIPCWDLTRNVTSETNSVLLFETYRAAPRPLGNALPHLNAAFLAEVSPCKTGDGIRVNNCRLAFGAFGTKHAIRARRVEEFLTGKVLNFGVLYEAIKLLRDSVVPEDGTSIPAYRSSLAVGFLYEFFGSLTEMKNGISRDWLCGYSNNVSL**************************VVQLSREYYPVGEPITKSGAALQASGEAIYVDDIPSPINCLYGAFIYSTKPLARIKGIEFKSESVPDVVTALLSYKDIPEGGQNIGSKTIFGSEPLFADELTRCAGQPVAFVVADSQKNADRAADVAVVDYEMGNLEPPILSVEEAVDRSSLFEVPSFLYPKPVGDISKGMNEADHRILAAEIKLGSQYYFYMETQTALAVPDEDNCLVVYSSIQCPESAHATIARCLGIPEHNVRVITRRVGGAFGGKAIKAMPVATACALAAYKLCRPVRIYVKRKTDMIMVGGRHPMKITYSVGFKSNGKITALQLNILIDAGLSPDVSPIMPSNMIGALKKYDWGALHFDIKVCRTNLPSRSAMRAPGEVQGSFIAEAVIEHVASTLSMEVDFVRNINLHTHKSLNLFYESSAGEYAEYTLPLIWDKLAVSSSFNQRTEMIKEFNRSNLWRKKGVCRLPIVHEVTLRSTPGKVSILSDGSVVVEVGGIEMGQGLWTKVKQMAAFALSSIKCGGTGNLLEKVRVVQADTLSVIQGGFTAGSTTSEASCQVVRDCCNILVERLTLLRERLQGQMGNVEWETLIQQVHICSSEALSTEFILFNFVCQRTCTDYLSPS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGQQQHGGTRHSVVFAVNGEKFEVSSVDPSTTLLEFLRYHTRFKSVKLGCGEGGCGACVVLLSKYNPELDQLEDFTISSCLTLLCSVNGCLITTSEGLGNSKTGFHPIHQRFAGFHASQCGFCTPGMCMSLFSALVDAEKTHRPEPPPGLSKLTISEAEKAIAGNLCRCTGYRPIADACKSFAADVDIEDLGINSFWAKGESKEVKISRLPPYKHNGELCRFPLFLKKENSSAMLLDVKGSWHSPISVQELRNVLESVEGSNQISSKLVAGNTGMGYYKEVEHYDKYIDIRYIPELSVIRRDQTGIEIGATVTISKAIEALKEETKEFHSEALMVFKKIAGHMEKIASRFIRNSASVGGNLVMAQRKHFPSDVATVLLGAGAMVNIMTGQKCEKLMLEEFLERPPLDSRSILLSVEIPCWDLTRNVTSETNSVLLFETYRAAPRPLGNALPHLNAAFLAEVSPCKTGDGIRVNNCRLAFGAFGTKHAIRARRVEEFLTGKVLNFGVLYEAIKLLRDSVVPEDGTSIPAYRSSLAVGFLYEFFGSLTEMKNGISRDWLCGYSNNVSLKDSHVQQNHKQFDESKVPTLLSSAEQVVQLSREYYPVGEPITKSGAALQASGEAIYVDDIPSPINCLYGAFIYSTKPLARIKGIEFKSESVPDVVTALLSYKDIPEGGQNIGSKTIFGSEPLFADELTRCAGQPVAFVVADSQKNADRAADVAVVDYEMGNLEPPILSVEEAVDRSSLFEVPSFLYPKPVGDISKGMNEADHRILAAEIKLGSQYYFYMETQTALAVPDEDNCLVVYSSIQCPESAHATIARCLGIPEHNVRVITRRVGGAFGGKAIKAMPVATACALAAYKLCRPVRIYVKRKTDMIMVGGRHPMKITYSVGFKSNGKITALQLNILIDAGLSPDVSPIMPSNMIGALKKYDWGALHFDIKVCRTNLPSRSAMRAPGEVQGSFIAEAVIEHVASTLSMEVDFVRNINLHTHKSLNLFYESSAGEYAEYTLPLIWDKLAVSSSFNQRTEMIKEFNRSNLWRKKGVCRLPIVHEVTLRSTPGKVSILSDGSVVVEVGGIEMGQGLWTKVKQMAAFALSSIKCGGTGNLLEKVRVVQADTLSVIQGGFTAGSTTSEASCQVVRDCCNILVERLTLLRERLQGQMGNVEWETLIQQVHICSSEALSTEFILFNFVCQRTCTDYLSPSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aldehyde oxidase 3 probableQ852M2
Probable aldehyde oxidase 2 probableQ852M1
Indole-3-acetaldehyde oxidase In higher plant aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions. In vitro, AO-gamma uses heptaldehyde, benzaldehyde, naphthaldehyde and cinnamaldehyde as substrates; AO-beta uses indole-3-acetaldehyde (IAAld), indole-3-aldehyde (IAld) and naphtaldehyde; the AAO2-AAO3 dimer uses abscisic aldehyde.probableQ7G192

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DGJ, chain A
Confidence level:very confident
Coverage over the Query: 12-63,74-186,256-265,294,367-373,401,488,550-552,597-1168
View the alignment between query and template
View the model in PyMOL
Template: 1RM6, chain A
Confidence level:very confident
Coverage over the Query: 602-1185
View the alignment between query and template
View the model in PyMOL
Template: 2W3S, chain A
Confidence level:very confident
Coverage over the Query: 12-218,232-324,336-423,434-549
View the alignment between query and template
View the model in PyMOL
Template: 2W3R, chain A
Confidence level:confident
Coverage over the Query: 14-143,160-200,224-244,256-327,338-434,451-456,467-544
View the alignment between query and template
View the model in PyMOL
Template: 1FIQ, chain B
Confidence level:probable
Coverage over the Query: 242-420,431-551
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3zyv, chain A very confident Alignment | Template Structure