BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 000982
         (1201 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3K6S|A Chain A, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K6S|C Chain C, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K6S|E Chain E, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K6S|G Chain G, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K71|A Chain A, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K71|C Chain C, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K71|E Chain E, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K71|G Chain G, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K72|A Chain A, Structure Of Integrin Alphax Beta2
 pdb|3K72|C Chain C, Structure Of Integrin Alphax Beta2
          Length = 1095

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 659 IYLKGEKYQLRGHINVQSRSPIGVHELP--ENIIVDILNGDGSISNRTTATL 708
           +YL G  + L G   +  R P+   E P  E  IV +++G GSIS+R  AT+
Sbjct: 101 MYLTGLCF-LLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATM 151


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.135    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,664,290
Number of Sequences: 62578
Number of extensions: 1738894
Number of successful extensions: 3902
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 14
Number of HSP's that attempted gapping in prelim test: 3892
Number of HSP's gapped (non-prelim): 25
length of query: 1201
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1091
effective length of database: 8,089,757
effective search space: 8825924887
effective search space used: 8825924887
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)