Citrus Sinensis ID: 001000

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190---
MVGKNNGINPVKGYCSVKGKFASLYARNSSLSETDNIRTWNSQILSTDTERQNTVQGDQSSDQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVIASEHNSRSRWIGKSGRNSLYDVPVQSANQIQAVDQSNETISDRETKGDTSALNLLAITYGNSSDSEEEQVEPNVPMCDDKETKLTECLLERKYQQNFHAAAAAAGSQDLSFISLDCEDEASLQISNVQPEFRRDYLNDKNPEMSECSVEFETDKHDCSKPNGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAFGRSSPASSPNKYDNGRRPARQRKVVAGKWCGRVWMSNQAHPFLVQKDPEEQELERSFHAWTTPDENFERKPESICQTTSTLVTRKYSRKRKMVAESVSTKKAKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKDVDLPDSSEVSSYQQKRSVSRRKQAKCIQREVGDSNDALPGNSLIQYRRIPKRKHAKCIGREDAVLDDLTDDSSLKQYRRIPRSKLAKHVAREDEVSDNSLRGTSDRQHTSIPKGKEFTCIDRDDAISDDSLQDNSRQLQFNRVPKSKQAEWIEREDAASDDSLEDYPHRLQHKKIPNIKQPKCIESEDPVLDNLLEKNTLRLHHQRILKSKRAKCVEREDAVSDDLLEDSSHMLPRRSQKSKQAKWMVREDAVSDDSLEDNSRQLYQRIPKSKPSKWIEREDAVSDDSLEDNSHQQHKRIPRDKQSKCTEMEDTVFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLDNKSHRRHCRTLRSKQLRTETLRKMKQETPSHMKPGKSRLTKQETSRLVKQVTSRQHSVKSEQNAKLFDSVVEQELEGGPSTRLRKRIPKPQKEFETKPKEKNPAAKKKVKNASVVKAPAGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHSAKKSRG
cccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccHHHHHHHHccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHccccccccccHHHHHHHHHccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccccccEEEcccEEccccccccccccccccHHHHHHHHccccccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHcccccccccccccccccccccccccccccccccccccccHHccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcEEEEEcccHHHHHHHHHccccccccEEEEccccccEEcccccccccccccccHHHHcccccccccccHccHHHHHHcccccHEEEccccccccHHHHHHHHHcccccccHHHccccccccccHHHHHHHHHHccccccccccccccccccccccccEcccccccEcEccccHHHHHHccccccccccccccccccHccccccccccccccccccEEEcccccccHcccccccccccccEEEccccccccccccccccccEEHHHHHHHHHHHHHccccccHHEEHEccccccHHHHHHHHHHHHHcccccHHHEEEccccHHHHHHHHHHccccccccccccEEEEEEEEEEEcccccccccccccccccHHHHHHccccccccccccccccccccccEEEEEccccccccccccccccHcccccccccHHHHcccccccccccccccccccccEEEEEccccccccEEEEcccccccccccccccccccccHcHHHHHHccccccccccEEEccccccccccccccHHHcccccccccccEEEEcccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHEEEccccccccccccccEEccccHHHHHcHcccccccccccccccccccccccccEccccHHHHHEcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccEEccccHHHHHHHccccccccccccccccEccccHHHHHEHEccccccccccccccccEccccHHHHHHHHcccccccccccccccccEEEccccccHHHHHEHHccccccccccccccEEEccccccccccccccccccEccccHHHHHHHHccccccccccccccccccccccccHHEHEHHcccccccccccccccEcccccHHEHEHEccccccccccccccccccccccccccHHHHcHHHEHEHHcccccccEccHHHccccEccccHHHHHHHHEEcccHccccEcccccHHEHEHEccccccccccHHHcccHEccccHHHHHHHHccccccccccccccccEEEccccHEEEEEEEEcccccccc
mvgknnginpvkgycsvkgkfaslyarnsslsetdnirTWNSQILSTdterqntvqgdqssdqrlfscVTCGILSFACVAviqpreptarYLMSAdcsffndwivgsgvsgafraageDVIASEHnsrsrwigksgrnslydvpvqsanqiqavdqsnetisdretkgdtSALNLLAITygnssdseeeqvepnvpmcddketKLTECLLERKYQQNFHAAAAaagsqdlsfisldcedeaslqisnvqpefrrdylndknpemsecsvefetdkhdcskpngfdgcfgdpiaasyaskcapvihggenvefsKAIVPVMnaemsfaprsdedssrmHVFCLEHAVEVEQqlrpiggvdifllchpdypKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIhlsldsedaipgngdwAVKLGINLFYsanlsrsplyskqmpynsiiynafgrsspasspnkydngrrparqrKVVAGkwcgrvwmsnqahpflvqkdpeeqelersfhawttpdenferkpesicqttstlvTRKYSRKRKMVAESVStkkakcidtedagskyslegdtrIQQRRILrnkpaklmekkdvdlpdssevssyqqkrSVSRRKQAKCIQrevgdsndalpgnsliqyrripkrkhakcigredavlddltddsslkqyrriprsklakhvaredevsdnslrgtsdrqhtsipkgkeftcidrddaisddslqdnsrqlqfnrvpkskqaewieredaasddsledyphrlqhkkipnikqpkciesedpvlDNLLEKNTLRLHHQRILKSkrakcveredavsddlledsshmlprrsqksKQAKWMVredavsddsleDNSRQLYqripkskpskwieredavsddslednshqqhkriprdkqskctemedtvfydsAEDNIQQFRRIARKRANFTEREDAVLYdlldnkshrrhcRTLRSKQLRTETLRKMKqetpshmkpgksrltkqETSRLVKQVTSRqhsvkseqnaKLFDSVVEQeleggpstrlrkripkpqkefetkpkeknpaakkkvknasvvkapaglnnakikdeeagyhcdmegctmsfgtKQELVLhkknicpvkgcgkkffshkYLVQHRrvhlddrplkcpwkgckmtfKWAWARTEHIRvhtgarpyvcaepgcgqtfrfvsdfsrhkrktghsakksrg
mvgknnginpvkgycsVKGKFASLYARnsslsetdniRTWNSQILSTDTERQNTVQGDQSSDQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVIasehnsrsrwigksGRNSLYDVPVQSANqiqavdqsnetisdretkgdtsaLNLLAITYgnssdseeeqvepnvpmcdDKETKLTECLLERKYQQNFHAAAAAAGSQDLSFISLDCEDEASLQISNVQPEFRRDYLNDKNPEMSECSVEFETDKHDCSKPNGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRihlsldsedaipgNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAfgrsspasspnkydngrrparqrKVVAGKWCGRVWMSNQAHPFLVQKDPEEQELERSFHAwttpdenferkpesicqttstlvtrkysrkrkmvaesvstkkakcidtedagskyslegdtriqqrrilrnkpaklmekkdvdlpdssevssyqqkrsvsrrkqakciqrevgdsndalpgnsliqyrripkrkhakcigredavlddltddsslkqyrriprsklakhvaredevsdnslrgtsdrqhtsipkgkeftciDRDDAIsddslqdnsrqlqfnrvpkskqaewieREDAASDDSLEDYPHRLqhkkipnikqpkcIESEDPVLDNLLEkntlrlhhqrilkskrakcveredavsddlledsshmlprrsqkskqakwMVREdavsddslednsrqlyqripkskpskwiEREDAvsddslednshqqhkriprdkqskctEMEDTVfydsaednIQQFRRIARKranfteredavlydlldnkshrrhcrtlrskqlrtetlrkmkqetpshmkpgksrltkqetSRLVKQVtsrqhsvkseqnaklfdsvveqeleggpstrlrkripkpqkefetkpkeknpaakkkvknasvvkapaglnnakikdeeAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHrrvhlddrplkcpwkgCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFrfvsdfsrhkrktghsakksrg
MVGKNNGINPVKGYCSVKGKFASLYARNSSLSETDNIRTWNSQILSTDTERQNTVQGDQSSDQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVIASEHNSRSRWIGKSGRNSLYDVPVQSANQIQAVDQSNETISDRETKGDTSALNLLAITYGNSSDSEEEQVEPNVPMCDDKETKLTECLLERKYQQNFHaaaaaaGSQDLSFISLDCEDEASLQISNVQPEFRRDYLNDKNPEMSECSVEFETDKHDCSKPNGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAFGRSSPASSPNKYDNGRRPARQRKVVAGKWCGRVWMSNQAHPFLVQKDPEEQELERSFHAWTTPDENFERKPESICQTTSTLVTRKYSRKRKMVAESVSTKKAKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKDVDLPDSSEVSSYQQKRSVSRRKQAKCIQREVGDSNDALPGNSLIQYRRIPKRKHAKCIGREDAVLDDLTDDSSLKQYRRIPRSKLAKHVAREDEVSDNSLRGTSDRQHTSIPKGKEFTCIDRDDAISDDSLQDNSRQLQFNRVPKSKQAEWIEREDAASDDSLEDYPHRLQHKKIPNIKQPKCIESEDPVLDNLLEKNTLRLHHQRILKSKRAKCVEREDAVSDDLLEDSSHMLPRRSQKSKQAKWMVREDAVSDDSLEDNSRQLYQRIPKSKPSKWIEREDAVSDDSLEDNSHQQHKRIPRDKQSKCTEMEDTVFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLDNKSHRRHCRTLRSKQLRTETLRKMKQETPSHMKPGKSRLTKQETSRLVKQVTSRQHSVKSEQNAKLFDSVVEQELEGGPSTRLRKRIPKPQKEFETkpkeknpaakkkvknasvvkapaGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHSAKKSRG
*********PVKGYCSVKGKFASLYAR**********RTW***********************RLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVIA********WI*****************************************NLLAIT*************************LTECLLERKYQQNFHAAAAAAGSQDLSFISLDCED******************************************NGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMN***************MHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAF**********************KVVAGKWCGRVWMSNQAHPFLV******************************************************************************************************************************************LIQYRRIPKRKHAKCIGREDAVL*****************************************************************************************************************************LDNLLEKNTLRLHHQRIL**********************************************************************************************************VFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLD*********************************************************************************************************************************EAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDF****************
**************CSVKGKFASLYARNS********************************DQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSG*********************************DVPV****Q***************TKGDTSALNLLAIT******************************************************************************************************************ASYASKCAPVI***********************P***EDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSA***********MPYNSIIYNAFGRS************************KWCGRVWMSNQAHPF************************************************************************************************************************************************************************************************************************************************************************************************************************CVEREDAVSDDLL********************VRED************************KWIEREDAVSDDSLE***HQQHKRIPRDKQSKCTEMEDTVFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLDNKSHRRHCRTL********************MKPGKSRL************TSRQHSVKSEQNAKLFDSVVEQ*LE*****RL*KRIPKPQKEFETKPKEKNPAAKKKVKNASVVKAPAGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHS***S**
MVGKNNGINPVKGYCSVKGKFASLYARNSSLSETDNIRTWNSQILST**************DQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVI********RWIGKSGRNSLYDVPVQSANQIQAVDQSNETISDRETKGDTSALNLLAITYGN*************PMCDDKETKLTECLLERKYQQNFHAAAAAAGSQDLSFISLDCEDEASLQISNVQPEFRRDYLNDKNPEMSECSVEFETDKHDCSKPNGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAFGR*********************VVAGKWCGRVWMSNQAHPFLVQKDPEEQELERSFHAWTTPDENFERKPESICQTTSTLVTR*****************AKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKD**************************IQREVGDSNDALPGNSLIQYRRIPKRKHAKCIGREDAVLDDLTDDSSLKQYRRIPRS****************************PKGKEFTCIDRDDAISDDSLQDNSRQLQFNRVPKSKQAEWIEREDAASDDSLEDYPHRLQHKKIPNIKQPKCIESEDPVLDNLLEKNTLRLHHQRIL************AVSDDLLEDSSH**************************EDNSRQLYQRIPKSKPSKWIERE**************************CTEMEDTVFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLDNKSHRRHCRTLRSKQLRTETLRKM*************************************QNAKLFDSVVE********TRLRKRIPKPQ********************ASVVKAPAGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDF****************
***********KGYCSVKGKFASLYARN*********************************DQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVIASEHNSRSRWIGKSGRNSLYDVPVQSANQIQAVDQSNETISDRETKGDTSALNLLAITYGN*******QVEPNVPMCDDKETKLTECLLERKYQ***HAAAAAAGSQDLSFISLDCEDEASLQISNVQPEFRRDYLN************F**DKHDCSKPNGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAFGRSS**SSPNKYDNGRRPARQRKVVAGKWCGRVWMSNQAHPFLVQKDPEEQELERSFHAWTTPDENFERKPESICQTTSTLVTRKYSRKRKMVAESVSTKKAKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKDVDLPDSSEVSSYQQKRSVSRRKQAKCIQREVGDSNDALPGNSLIQYRRIPKRKHAKCIGREDAVLDDLTDDSSLKQYRRIPRSKLAKH******VS*****GTSDRQHTSIPKGKEFTCIDRDDAISDDSLQDNSRQLQFNRVPKSKQAEWIEREDAASDDSLEDYPHRLQHKKIPNIKQPKCIESEDPVLDNLLEKNTLRLHHQRILKSKRAKCVEREDAVSDDLLEDSSHMLPRRSQKSKQAKWMVREDAVSDDSLEDNSRQLYQRIPKSKPSKWIEREDAVSDDSLEDNSHQQHKRIPRDKQSKCTEMEDTVFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLDNKSHRRHCRTLRSKQLRTETLRKMKQETPSHMKPGKSRLTKQETSRLVKQVTSRQHSVKSEQNAKLFDSVVEQELEGGPSTRLRKRIPKPQKEFETKPKEKNPAAKKKVKNASVVKAPAGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHSAK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKNNGINPVKGYCSVKGKFASLYARNSSLSETDNIRTWNSQILSTDTERQNTVQGDQSSDQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGAFRAAGEDVIASEHNSRSRWIGKSGRNSLYDVPVQSANQIQAVDQSNETISDRETKGDTSALNLLAITYGNSSDSEEEQVEPNVPMCDDKETKLTECLLERKYQQNFHAAAAAAGSQDLSFISLDCEDEASLQISNVQPEFRRDYLNDKNPEMSECSVEFETDKHDCSKPNGFDGCFGDPIAASYASKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAFGRSSPASSPNKYDNGRRPARQRKVVAGKWCGRVWMSNQAHPFLVQKDPEEQELERSFHAWTTPDENFERKPESICQTTSTLVTRKYSRKRKMVAESVSTKKAKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKDVDLPDSSEVSSYQQKRSVSRRKQAKCIQREVGDSNDALPGNSLIQYRRIPKRKHAKCIGREDAVLDDLTDDSSLKQYRRIPRSKLAKHVAREDEVSDNSLRGTSDRQHTSIPKGKEFTCIDRDDAISDDSLQDNSRQLQFNRVPKSKQAEWIEREDAASDDSLEDYPHRLQHKKIPNIKQPKCIESEDPVLDNLLEKNTLRLHHQRILKSKRAKCVEREDAVSDDLLEDSSHMLPRRSQKSKQAKWMVREDAVSDDSLEDNSRQLYQRIPKSKPSKWIEREDAVSDDSLEDNSHQQHKRIPRDKQSKCTEMEDTVFYDSAEDNIQQFRRIARKRANFTEREDAVLYDLLDNKSHRRHCRTLRSKQLRTETLRKMKQETPSHMKPGKSRLTKQETSRLVKQVTSRQHSVKSEQNAKLFDSVVEQELEGGPSTRLRKRIPKPQKEFETKPKEKNPAAKKKVKNASVVKAPAGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKNICPVKGCGKKFFSHKYLVQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHSAKKSRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1193 2.2.26 [Sep-21-2011]
Q9STM31360 Lysine-specific demethyla yes no 0.237 0.208 0.527 1e-77
Q6BDA01340 Probable lysine-specific no no 0.124 0.110 0.543 2e-43
Q58DZ6 567 Zinc finger protein 143 O yes no 0.088 0.186 0.398 2e-18
Q91853 565 Zinc finger protein 143 O N/A no 0.088 0.187 0.389 1e-17
P52747 638 Zinc finger protein 143 O yes no 0.088 0.166 0.380 1e-17
Q5XIU2 638 Zinc finger protein 143 O yes no 0.088 0.166 0.389 3e-17
O70230 638 Zinc finger protein 143 O yes no 0.088 0.166 0.389 3e-17
P36508 570 Zinc finger protein 76 OS no no 0.088 0.185 0.371 9e-17
Q8BMU0 568 Zinc finger protein 76 OS no no 0.088 0.186 0.371 1e-16
B4F7E9 568 Zinc finger protein 76 OS no no 0.088 0.186 0.371 1e-16
>sp|Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 OS=Arabidopsis thaliana GN=REF6 PE=1 SV=1 Back     alignment and function desciption
 Score =  292 bits (748), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 197/288 (68%), Gaps = 5/288 (1%)

Query: 319  VMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLV 378
            ++   + F PRSD+DS R+HVFCLEHA EVEQQLRP GG+++ LLCHP+YP++ AEAK+V
Sbjct: 717  LLEIALPFIPRSDDDSCRLHVFCLEHAAEVEQQLRPFGGINLMLLCHPEYPRIEAEAKIV 776

Query: 379  AEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSP 438
            AEEL I+   ++  FR  T+EDE+ I  +LD+ +A  GN DW VKLG+NL YSA LSRSP
Sbjct: 777  AEELVINHEWNDTEFRNVTREDEETIQAALDNVEAKGGNSDWTVKLGVNLSYSAILSRSP 836

Query: 439  LYSKQMPYNSIIYNAFGRSSP-ASSPNKYD-NGRRPARQRKVVAGKWCGRVWMSNQAHPF 496
            LYSKQMPYNSIIY AFGRSSP ASSP+K   +G+R +RQRK V GKWCG+VWMS+Q HPF
Sbjct: 837  LYSKQMPYNSIIYKAFGRSSPVASSPSKPKVSGKRSSRQRKYVVGKWCGKVWMSHQVHPF 896

Query: 497  LVQKDPEEQELERSFHAWTTPDENFERK---PESICQTTSTLVTRKYSRKRKMVAESVST 553
            L+++D E +E ERS H     DE+   K   P ++ + ++T+  RKY RKRK+ A++V  
Sbjct: 897  LLEQDLEGEESERSCHLRVAMDEDATGKRSFPNNVSRDSTTMFGRKYCRKRKIRAKAVPR 956

Query: 554  KKAKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKDVDLPDSS 601
            KK      ED  S  + E  +  QQ R   N+     E  +    DSS
Sbjct: 957  KKLTSFKREDGVSDDTSEDHSYKQQWRASGNEEESYFETGNTASGDSS 1004
Histone demethylase that demethylates 'Lys-27' (H3K27me) of histone H3. Demethylates both tri- (H3K27me3) and di-methylated (H3K27me2) H3K27me. Demethylates also H3K4me3/2 and H3K36me3/2 in an in vitro assay. Involved in the transcriptional regulation of hundreds of genes regulating developmental patterning and responses to various stimuli. Involved in the regulation of flowering time by repressing FLOWERING LOCUS C (FLC) expression.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: -
>sp|Q6BDA0|ELF6_ARATH Probable lysine-specific demethylase ELF6 OS=Arabidopsis thaliana GN=ELF6 PE=1 SV=1 Back     alignment and function description
>sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 Back     alignment and function description
>sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 Back     alignment and function description
>sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 Back     alignment and function description
>sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 Back     alignment and function description
>sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 Back     alignment and function description
>sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 Back     alignment and function description
>sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 Back     alignment and function description
>sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1193
255540401 1736 nucleic acid binding protein, putative [ 0.972 0.668 0.444 0.0
356507319 1567 PREDICTED: lysine-specific demethylase R 0.901 0.686 0.443 0.0
356507321 1552 PREDICTED: lysine-specific demethylase R 0.904 0.695 0.452 0.0
356518921 1586 PREDICTED: lysine-specific demethylase R 0.893 0.672 0.434 0.0
356518923 1565 PREDICTED: lysine-specific demethylase R 0.900 0.686 0.440 0.0
358348993 1621 Lysine-specific demethylase 5B [Medicago 0.915 0.673 0.430 0.0
224119560747 predicted protein [Populus trichocarpa] 0.614 0.981 0.506 0.0
225456789 1295 PREDICTED: lysine-specific demethylase R 0.461 0.425 0.574 1e-168
3071361271126 nucleic acid binding protein [Cucumis me 0.668 0.707 0.420 1e-155
449469757 1576 PREDICTED: lysine-specific demethylase R 0.664 0.503 0.405 1e-152
>gi|255540401|ref|XP_002511265.1| nucleic acid binding protein, putative [Ricinus communis] gi|223550380|gb|EEF51867.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1308 (44%), Positives = 772/1308 (59%), Gaps = 148/1308 (11%)

Query: 4    KNNGINPVKGYCSVKGKFASLYARN--SSLSETDNIRTWNSQILSTDTERQNTVQGDQSS 61
            +N GI+  KG  SVK KFASL  RN  SSL+  +N  T N     T TE + T  GD+ S
Sbjct: 457  RNYGIDQSKGTISVKEKFASLCERNRFSSLNGNENKHTTN-----TRTENKGTTHGDKLS 511

Query: 62   DQRLFSCVTCGILSFACVAVIQPREPTARYLMSADCSFFNDWIVGSGVSGA-FRAAGEDV 120
            DQRLFSCVTCGILSF C+AV+QP E  ARYLMSADCSFFNDWIVGSG +         D 
Sbjct: 512  DQRLFSCVTCGILSFDCIAVVQPTETAARYLMSADCSFFNDWIVGSGATNNRLTTTNGDP 571

Query: 121  IASEHNSRSRWIGKSGRNSLYDVPVQSAN-QIQAVDQSNETISDRETKGDTSALNLLAIT 179
               + +  + W+  S  + LYDVPVQS N Q Q +D+S +  S+   +G++SAL LLA+ 
Sbjct: 572  NTCQLDQPTGWVENSVVDHLYDVPVQSVNYQPQKIDKS-KVNSNATMQGESSALGLLALN 630

Query: 180  YGNSSDSEEEQVEPNV-------PMCD-DKETKLTECLLERKYQQNFHAAAAAAGSQDLS 231
            YGNSSDSEE+Q EP+V       P C  + + K   C L    Q+  H       S  LS
Sbjct: 631  YGNSSDSEEDQDEPDVSDHAIDMPTCSSENKYKYQNCALPSFKQECHHDETV---SHTLS 687

Query: 232  FISLDCEDEASLQISNVQPEF--RRDYLNDKNPEMSECSVEFETDKHDCSKPNGFDGCFG 289
             ++LDC D+ SLQ  +   E   R     D  P+   C ++F TD  +   PNG +  FG
Sbjct: 688  LVTLDCGDKVSLQTDDCHKEHGDRAGNFKDGTPD---CFLDFGTDNME---PNGSECRFG 741

Query: 290  DPIAASYA-SKCAPVIHGGENVEFSKAIVPVMNAEMSFAPRSDEDSSRMHVFCLEHAVEV 348
            D ++ S+  S C+P +H  E ++F + +VP  N +M FA RSDEDSSRMHVFCLEHAVEV
Sbjct: 742  DAVSISHINSNCSPAVHDTEKMKFRR-VVPRGNGDMPFAQRSDEDSSRMHVFCLEHAVEV 800

Query: 349  EQQLRPIGGVDIFLLCHPDYPKMVAEAKLVAEELGIDSLCDEISFRVATKEDEKRIHLSL 408
            EQQ R IGGV I LLCHP+YP++ AEAKLV+EELGID L ++I+FR ATK DE+ I  +L
Sbjct: 801  EQQFRSIGGVHILLLCHPEYPRLEAEAKLVSEELGIDHLWNDIAFRDATKNDEENIQSAL 860

Query: 409  DSEDAIPGNGDWAVKLGINLFYSANLSRSPLYSKQMPYNSIIYNAFGRSSPASSPNKYD- 467
            DSE+AIPGNGDWAVKLGINLFYSA+LS S LYSKQMPYNS+IY AFGR SPASSP K + 
Sbjct: 861  DSEEAIPGNGDWAVKLGINLFYSASLSHSSLYSKQMPYNSVIYKAFGRVSPASSPTKLNV 920

Query: 468  NGRRPARQRKVVAGKWCGRVWMSNQAHPFLVQKDPE----EQELERSFHAWTTPDENFER 523
             GRR  +Q+KVVAG+WCG+VWMSNQ H FL++   E    E+E + SFH W   DE  ER
Sbjct: 921  YGRRSGKQKKVVAGRWCGKVWMSNQVHNFLLKNASEDRDQEEEQDGSFHGWKMLDEKVER 980

Query: 524  KPESICQTTSTLVTRKYSRKRKMVAESVSTKKAKCIDTEDAGSKYSLEGDTRIQQRRILR 583
            K ++  +T + L   K  RKRK+   +   KK K  +TE A S    E  +  Q  ++  
Sbjct: 981  KLQNFYKTETALAAAKSVRKRKLTTVTRPIKKVKSPETEAAASDDLEEDVSHKQHTKVYS 1040

Query: 584  NKPAKLMEKKDVDLPDSSEVSSYQQKRSVSRRKQAKCIQREVGDSNDALPGNS-LIQYRR 642
             K  K +E+   ++   S  +S+QQ     R KQAK ++R+   S+D+L GN+   Q+RR
Sbjct: 1041 RKQTKHIER---EVSYDSLDNSHQQHGKTHRIKQAKSVERDDAVSDDSLGGNTHQQQHRR 1097

Query: 643  IPKRKHAKCIGREDAVLDDLTDDSSLKQYRRI--PRSKLAKHVAREDEVSDNSLRGTSDR 700
            IP+ K  K I  E+ V D L   +S KQ+ RI  PRSK  K++ R+ E+SD+SL G  + 
Sbjct: 1098 IPRSKQVKYIDSENDVSDTLIGSNSQKQHSRIPKPRSKQVKYIRRKSEISDDSLEGDINE 1157

Query: 701  QHTSIPKGKEFTCIDRDDAISDDSLQDNSRQLQFNRVPKSKQAEWIEREDAASDDSLEDY 760
             H   P+  +     R+ A+SDDSL+++S +     V +SKQA + E EDA SDDS+E+ 
Sbjct: 1158 WHGRGPRSTQAGFYGREVAVSDDSLEESSHR-PLGTVRRSKQAAYFESEDALSDDSVENS 1216

Query: 761  PHRLQHKKIPNIKQPKCIESEDPVLDNLLEKNTLRLHHQRILKSKRAKCVEREDAVSDDL 820
              + Q++++      K  E ED V D++LE+NT +       +S++ K V+RE  VSD+L
Sbjct: 1217 SLQ-QNRRVSRGSLAKYFEREDEVSDDMLEENTFQ-QCTGSHRSRKKKFVDREGEVSDNL 1274

Query: 821  LEDSSHMLPRRSQKSKQAKWMVREDAVSDDSLEDNSRQLYQRIPKSKPSKWIEREDAVSD 880
            L++S+ +  RR  +SKQ +++ RED VSDDSLEDNS+Q  +RIP SK +K++E EDAVSD
Sbjct: 1275 LDESTQLQHRRIFRSKQGRFVEREDEVSDDSLEDNSQQ-QRRIPTSKRAKFVESEDAVSD 1333

Query: 881  DSLEDNSHQQHKRIPRDKQSKCTEMEDTVFYDSAEDNIQQF--RRIAR-KRANFTEREDA 937
            + LED++H +H RIPR K++K   ME     D  ++N  Q+  R+  R K   F ERED 
Sbjct: 1334 E-LEDDTHLKHWRIPRSKKAKI--MEREACSDDLQENDAQWQPRKTPRGKPVKFIERED- 1389

Query: 938  VLYDLLDNKSHRRHCRTLRSKQLRT---ETLRKMKQETPSHMKPGKSR-------LTKQE 987
             + D L+  +H +  +T R K + +   E +    QE  +  +P K+          K++
Sbjct: 1390 -VSDDLEEATHWQQRKTSRHKPVTSFEREDVSDDLQEENTRWQPRKTTRGKQTKFFEKED 1448

Query: 988  TSRLVKQVTSRQHSVKSEQN-----AKLFDSVVEQELEGGPSTRLRKRI----------P 1032
             S  +++  +R H  K+ ++     A+L D+V +  LE   ST+  +RI           
Sbjct: 1449 VSDDLQEDDTRWHPSKTPKSKQAKYAELEDAVSDDLLEDN-STKQHRRILRNKQKSGTLG 1507

Query: 1033 KPQKEFETKPKEKNPAAKKKVKNASVVKA-------PAGLNNAKIKDEEAGYHCDMEGCT 1085
            K  +E     K+    AKKK  + S+ K        P   N+   +  E+    ++EG  
Sbjct: 1508 KVNRESIQHVKQGTARAKKKENSKSIKKEKEVKQENPGFRNSKSGRLFESHVEEEVEGGP 1567

Query: 1086 MS--------------FGTKQELVLHKKNI------------------------CPVKGC 1107
             +                 K++L  +KK +                        C ++GC
Sbjct: 1568 STRLRKRPSKASKESETKLKEKLQSNKKKVRGSASAVKRASGQKNNKDEDAEYQCDIEGC 1627

Query: 1108 GKKFFS------HK-----------------YLVQHRRVHLDDRPLKCPWKGCKMTFKWA 1144
               F S      HK                 YLVQHRRVHLDDRPLKCPWKGCK+TFKWA
Sbjct: 1628 TMSFGSKQELAVHKRNICPVKGCGKTFLSHKYLVQHRRVHLDDRPLKCPWKGCKVTFKWA 1687

Query: 1145 WARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHSAKKSR 1192
            WARTEHIRVHTGARPYVCAE GCGQTFRFVSDFSRHKRKTGHS KKSR
Sbjct: 1688 WARTEHIRVHTGARPYVCAEEGCGQTFRFVSDFSRHKRKTGHSVKKSR 1735

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356507319|ref|XP_003522415.1| PREDICTED: lysine-specific demethylase REF6-like [Glycine max] Back     alignment and taxonomy information
>gi|356507321|ref|XP_003522416.1| PREDICTED: lysine-specific demethylase REF6-like [Glycine max] Back     alignment and taxonomy information
>gi|356518921|ref|XP_003528124.1| PREDICTED: lysine-specific demethylase REF6-like [Glycine max] Back     alignment and taxonomy information
>gi|356518923|ref|XP_003528125.1| PREDICTED: lysine-specific demethylase REF6-like [Glycine max] Back     alignment and taxonomy information
>gi|358348993|ref|XP_003638525.1| Lysine-specific demethylase 5B [Medicago truncatula] gi|355504460|gb|AES85663.1| Lysine-specific demethylase 5B [Medicago truncatula] Back     alignment and taxonomy information
>gi|224119560|ref|XP_002318104.1| predicted protein [Populus trichocarpa] gi|222858777|gb|EEE96324.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225456789|ref|XP_002275305.1| PREDICTED: lysine-specific demethylase REF6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|307136127|gb|ADN33973.1| nucleic acid binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449469757|ref|XP_004152585.1| PREDICTED: lysine-specific demethylase REF6-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1193
TAIR|locus:5049556441360 REF6 "relative of early flower 0.334 0.293 0.441 5.2e-104
TAIR|locus:21466531340 ELF6 "EARLY FLOWERING 6" [Arab 0.090 0.080 0.648 1.3e-51
UNIPROTKB|P17026224 ZNF22 "Zinc finger protein 22" 0.092 0.491 0.349 2.9e-16
UNIPROTKB|G3MYC4168 G3MYC4 "Uncharacterized protei 0.091 0.648 0.384 6.6e-16
RGD|620229237 Zfp422 "zinc finger protein 42 0.099 0.502 0.356 1.1e-15
UNIPROTKB|J9P6L5529 ZNF529 "Uncharacterized protei 0.095 0.215 0.377 1.2e-15
MGI|MGI:1914505237 Zfp422 "zinc finger protein 42 0.099 0.502 0.356 1.4e-15
UNIPROTKB|E7EX64340 ZNF76 "Zinc finger protein 76" 0.091 0.320 0.376 2.7e-14
UNIPROTKB|E7EN86 610 ZNF143 "Zinc finger protein 14 0.091 0.178 0.384 2.9e-14
ZFIN|ZDB-GENE-040426-1586 647 znf143b "zinc finger protein 1 0.091 0.168 0.393 3e-14
TAIR|locus:504955644 REF6 "relative of early flowering 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 767 (275.1 bits), Expect = 5.2e-104, Sum P(2) = 5.2e-104
 Identities = 186/421 (44%), Positives = 254/421 (60%)

Query:   319 VMNAEMSFAPRSDEDSSRMHVFCLEHAVEVEQQLRPIGGVDIFLLCHPDYPKMVAEAKLV 378
             ++   + F PRSD+DS R+HVFCLEHA EVEQQLRP GG+++ LLCHP+YP++ AEAK+V
Sbjct:   717 LLEIALPFIPRSDDDSCRLHVFCLEHAAEVEQQLRPFGGINLMLLCHPEYPRIEAEAKIV 776

Query:   379 AEELGIDSLCDEISFRVATKEDEKRIHLSLDSEDAIPGNGDWAVKLGINLFYSANLSRSP 438
             AEEL I+   ++  FR  T+EDE+ I  +LD+ +A  GN DW VKLG+NL YSA LSRSP
Sbjct:   777 AEELVINHEWNDTEFRNVTREDEETIQAALDNVEAKGGNSDWTVKLGVNLSYSAILSRSP 836

Query:   439 LYSKQMPYNSIIYNAFGRSSP-ASSPNKYD-NGRRPARQRKVVAGKWCGRVWMSNQAHPF 496
             LYSKQMPYNSIIY AFGRSSP ASSP+K   +G+R +RQRK V GKWCG+VWMS+Q HPF
Sbjct:   837 LYSKQMPYNSIIYKAFGRSSPVASSPSKPKVSGKRSSRQRKYVVGKWCGKVWMSHQVHPF 896

Query:   497 LVQKDPEEQELERSFHAWTTPDENFERK---PESICQTTSTLVTRKYSRKRKMVAESVST 553
             L+++D E +E ERS H     DE+   K   P ++ + ++T+  RKY RKRK+ A++V  
Sbjct:   897 LLEQDLEGEESERSCHLRVAMDEDATGKRSFPNNVSRDSTTMFGRKYCRKRKIRAKAVPR 956

Query:   554 KKAKCIDTEDAGSKYSLEGDTRIQQRRILRNKPAKLMEKKDVDLPDSSEVSSYQQKRSVS 613
             KK      ED  S  + E  +  QQ R   N+     E  +    DSS   S   K  + 
Sbjct:   957 KKLTSFKREDGVSDDTSEDHSYKQQWRASGNEEESYFETGNTASGDSSNQMSDPHK-GII 1015

Query:   614 RRKQAKCIQREVGDSNDALPGNSL-IQY--RRIPKRKHAKCIGREDAVLDDLTDDSSL-K 669
             R K  K    E  +S+D +   SL  +Y  R     + +   G + ++ D   DD  + +
Sbjct:  1016 RHKGYK----EF-ESDDEVSDRSLGEEYTVRACAASESSMENGSQHSMYDHDDDDDDIDR 1070

Query:   670 QYRRIPRSKLAKHVARED---EVSDNSLRGTSDRQHTSIPKGKEFTCIDRDDAISDDSLQ 726
             Q R IPRS+  + V R     E  DN +   S R   SI   +    +   D+ +++SL+
Sbjct:  1071 QPRGIPRSQQTR-VFRNPVSYESEDNGVYQQSGR--ISISNRQANRMVGEYDS-AENSLE 1126

Query:   727 D 727
             +
Sbjct:  1127 E 1127
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IMP
GO:0035067 "negative regulation of histone acetylation" evidence=IMP
GO:0009741 "response to brassinosteroid stimulus" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0033169 "histone H3-K9 demethylation" evidence=IMP
GO:0048366 "leaf development" evidence=IMP
TAIR|locus:2146653 ELF6 "EARLY FLOWERING 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P17026 ZNF22 "Zinc finger protein 22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYC4 G3MYC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|620229 Zfp422 "zinc finger protein 422" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6L5 ZNF529 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1914505 Zfp422 "zinc finger protein 422" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E7EX64 ZNF76 "Zinc finger protein 76" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EN86 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1586 znf143b "zinc finger protein 143b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0015022001
hypothetical protein (747 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1193
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.86
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.73
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.43
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.43
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.18
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.18
KOG3608 467 consensus Zn finger proteins [General function pre 99.14
KOG3576267 consensus Ovo and related transcription factors [T 99.09
KOG3576267 consensus Ovo and related transcription factors [T 99.06
KOG3608467 consensus Zn finger proteins [General function pre 98.92
PHA00733128 hypothetical protein 98.54
PLN03086567 PRLI-interacting factor K; Provisional 98.44
PLN03086567 PRLI-interacting factor K; Provisional 98.41
PHA0276855 hypothetical protein; Provisional 98.05
KOG3993500 consensus Transcription factor (contains Zn finger 97.89
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.83
PHA0276855 hypothetical protein; Provisional 97.73
PHA00733128 hypothetical protein 97.54
KOG3993 500 consensus Transcription factor (contains Zn finger 97.37
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.09
PHA0061644 hypothetical protein 96.84
PHA0073279 hypothetical protein 96.77
COG5189423 SFP1 Putative transcriptional repressor regulating 96.13
PHA0073279 hypothetical protein 96.04
PHA0061644 hypothetical protein 96.02
COG5189423 SFP1 Putative transcriptional repressor regulating 95.97
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.62
COG5048467 FOG: Zn-finger [General function prediction only] 95.39
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.04
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 94.72
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.66
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 93.31
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 93.22
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 92.26
PRK04860160 hypothetical protein; Provisional 91.3
COG5048467 FOG: Zn-finger [General function prediction only] 90.88
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 90.5
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 88.84
smart0035526 ZnF_C2H2 zinc finger. 88.69
smart0035526 ZnF_C2H2 zinc finger. 87.77
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 87.53
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 83.01
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 82.03
PRK04860160 hypothetical protein; Provisional 81.74
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information 
Probab=99.86  E-value=3.2e-22  Score=216.62  Aligned_cols=134  Identities=22%  Similarity=0.440  Sum_probs=126.1

Q ss_pred             CCCCccccccCCcccccCcccccccccccC---CCccccCCCCCCCcccChhHHhhhhccc---cCcCCCCCcccChhHH
Q 001000         1044 EKNPAAKKKVKNASVVKAPAGLNNAKIKDE---EAGYHCDMEGCTMSFGTKQELVLHKKNI---CPVKGCGKKFFSHKYL 1117 (1193)
Q Consensus      1044 ~k~~k~kC~iC~k~f~kk~~L~~H~riHtg---EKpyqCdiegCGKsFssks~Lk~Hkr~h---CpCe~CgKsFsskssL 1117 (1193)
                      .+...++|..|++.+.....|.+|..+|..   .+.+.|.+  |||.|.....|..|+++|   |.|.+|||.|.+.+.|
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~--C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLL  203 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKY--CGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLL  203 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCC--CCceeeehHHHhhHhhccCCCcccccccccccchHHh
Confidence            356788999999999999999999999974   57799988  999999999999999976   9999999999999999


Q ss_pred             HhhhhhccCCCCCCCCCCCCCccccChHHHHHHHhhhCCCCceecCCCCcCCcccChhhHHHhhhh
Q 001000         1118 VQHRRVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRK 1183 (1193)
Q Consensus      1118 q~HqRvHtGEKPykCp~~eCGKtFs~kS~LkrH~RiHTGEKPYkC~epGCGKsFs~sSsL~rH~Rt 1183 (1193)
                      +.|+|+|||||||.|  ..|+|+|..+++|+.||++|.+.|+|+|..  |+|+|+..+-|.+|...
T Consensus       204 QGHiRTHTGEKPF~C--~hC~kAFADRSNLRAHmQTHS~~K~~qC~~--C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  204 QGHIRTHTGEKPFSC--PHCGKAFADRSNLRAHMQTHSDVKKHQCPR--CGKSFALKSYLNKHSES  265 (279)
T ss_pred             hcccccccCCCCccC--CcccchhcchHHHHHHHHhhcCCccccCcc--hhhHHHHHHHHHHhhhh
Confidence            999999999999999  669999999999999999999999999988  99999999999999865

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1193
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-11
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 7e-09
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-08
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 9e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 6e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-06
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 5e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 8e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 5e-05
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 1e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-04
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 68/125 (54%), Gaps = 14/125 (11%)
Query: 1079 CDMEGCTMSFGTKQELVLH----------KKNICPVKGCGKKF--FSHKY-LVQHRRVHL 1125
            C  +GC+  F ++++LV H          K+ +C   GC ++   F  +Y LV H R H 
Sbjct: 4    CRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHT 63
Query: 1126 DDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTG 1185
             ++P KC ++GC+ ++        H+R HTG +PY+C   GC + F   SD ++H+ +T 
Sbjct: 64   GEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRT- 122
Query: 1186 HSAKK 1190
            HS +K
Sbjct: 123  HSNEK 127
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1193
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-17
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 2e-14
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 5e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-21
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-19
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-17
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-12
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-10
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 9e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 7e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-04
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
 Score = 92.3 bits (230), Expect = 2e-21
 Identities = 31/124 (25%), Positives = 44/124 (35%), Gaps = 10/124 (8%)

Query: 1077 YHCDMEGCTMSFGTKQELVLHKKN-------ICPVKGCGKKFFSHKYLVQHRRVHLD--D 1127
            + C  EGC   F +   L  H           C   GC  +F +   + +H     +   
Sbjct: 43   FPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKI 102

Query: 1128 RPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRK-TGH 1186
                C ++ C   FK       H   HT   PY C   GC + F   S   RH++   G+
Sbjct: 103  CVYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGY 162

Query: 1187 SAKK 1190
              KK
Sbjct: 163  PCKK 166
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1193
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.86
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.83
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.81
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.81
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.76
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.76
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.75
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.75
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.73
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.68
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.68
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.65
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.64
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.6
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.6
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.59
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.57
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.56
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.55
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.54
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.53
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.52
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.49
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.49
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.49
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.47
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.47
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.45
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.43
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.43
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.41
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.38
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.35
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.33
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.31
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.3
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.27
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.26
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.26
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.25
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.25
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.24
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.24
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.21
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.15
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.1
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.1
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.1
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.01
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.01
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.01
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.0
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.0
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.99
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.98
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.96
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.94
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.9
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.89
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.87
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.86
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.85
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.83
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.8
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.8
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.79
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.79
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.78
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.78
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.77
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.77
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.77
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.75
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.75
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.75
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.74
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.73
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.73
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.72
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.71
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.71
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.71
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.69
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.69
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.69
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.68
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.67
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.67
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.66
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.66
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.65
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.65
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.64
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.64
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.64
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.62
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.62
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.61
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.61
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.6
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.59
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.59
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.57
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.56
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.55
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.53
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.52
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.51
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.5
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.5
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.49
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.47
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.44
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.32
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.31
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.31
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.31
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.29
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.29
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.29
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.28
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.28
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.28
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.28
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.28
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.27
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.27
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.27
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.27
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.27
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.27
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.26
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.26
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.26
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.26
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.26
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.26
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.26
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.25
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.25
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.25
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.25
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.25
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.25
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.25
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.25
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.25
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.25
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.25
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.25
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.25
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.25
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.24
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.24
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.24
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.24
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.24
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.24
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.23
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.23
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.23
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.23
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.23
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.23
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.23
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.23
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.23
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.23
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.23
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.22
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.22
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.22
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.22
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.22
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.22
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.22
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.22
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.22
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.21
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.21
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.21
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.21
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.2
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.2
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.19
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.19
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.19
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.18
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.18
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.18
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.17
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.17
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.17
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.16
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.16
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.12
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.11
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.09
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.07
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.06
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.02
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.0
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.0
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.99
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.99
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 97.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.97
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 97.96
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.96
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.95
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 97.93
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 97.93
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.91
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.9
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.9
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.9
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.88
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.86
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.84
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.81
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.8
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.8
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.78
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.76
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.75
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.73
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.73
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.72
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.72
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.72
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.7
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.66
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.66
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.63
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.57
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.55
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.5
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.48
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.4
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.36
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.33
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.33
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.29
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.29
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.29
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.24
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.23
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.2
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.17
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.14
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.14
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.12
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.11
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.08
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.06
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.04
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.02
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.02
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.07
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 96.99
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.99
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.02
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 96.96
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.95
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.01
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.0
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.93
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.92
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.88
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.87
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.84
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.79
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.66
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.59
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.47
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.47
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.3
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 93.52
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 91.01
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 86.03
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 83.99
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 81.22
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.86  E-value=2e-22  Score=203.82  Aligned_cols=138  Identities=29%  Similarity=0.533  Sum_probs=123.9

Q ss_pred             CccccccCCcccccCcccccccccccCCCccccCCCCCCCcccChhHHhhhhcc-----ccCcCCCCCcccChhHHHhhh
Q 001000         1047 PAAKKKVKNASVVKAPAGLNNAKIKDEEAGYHCDMEGCTMSFGTKQELVLHKKN-----ICPVKGCGKKFFSHKYLVQHR 1121 (1193)
Q Consensus      1047 ~k~kC~iC~k~f~kk~~L~~H~riHtgEKpyqCdiegCGKsFssks~Lk~Hkr~-----hCpCe~CgKsFsskssLq~Hq 1121 (1193)
                      ..+.|..|+..|.....|..|+++|.++++|.|.+  |++.|.....|..|++.     ++.|..|++.|.....|..|+
T Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  125 (190)
T 2i13_A           48 KPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPE--CGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQ  125 (190)
T ss_dssp             CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTT--TCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHH
T ss_pred             CCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcc--cCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHH
Confidence            45789999999999999999999999999999988  99999999999999764     478999999999999999999


Q ss_pred             hhccCCCCCCCCCCCCCccccChHHHHHHHhhhCCCCceecCCCCcCCcccChhhHHHhhhhhcCCCCCCC
Q 001000         1122 RVHLDDRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKTGHSAKKSR 1192 (1193)
Q Consensus      1122 RvHtGEKPykCp~~eCGKtFs~kS~LkrH~RiHTGEKPYkC~epGCGKsFs~sSsL~rH~Rth~HsgeK~~ 1192 (1193)
                      ++|++++||.|  ..|++.|.....|..|+++|++++||.|..  |++.|.....|..|+++  |.|+||+
T Consensus       126 ~~h~~~~~~~C--~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~--C~~~f~~~~~L~~H~~~--H~~~k~~  190 (190)
T 2i13_A          126 RTHTGEKPYKC--PECGKSFSREDNLHTHQRTHTGEKPYKCPE--CGKSFSRRDALNVHQRT--HTGKKTS  190 (190)
T ss_dssp             HHHHCCCCEEC--TTTCCEESCHHHHHHHHHHHHCCCCEECTT--TCCEESSHHHHHHHHTT--C------
T ss_pred             HHhCCCCCeEC--CCCCcccCCHHHHHHHHHhcCCCCCeECCC--CCCccCCHHHHHHHHHh--cCCCCCC
Confidence            99999999999  669999999999999999999999999988  99999999999999998  8888875
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1193
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.003
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 7e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.9 bits (109), Expect = 2e-07
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 1131 KCPWKGCKMTFKWAWARTEHIRVHTGARPYVC 1162
             CP   C  +F +     EH+++H+  R Y+C
Sbjct: 3    SCPEPACGKSFNFKKHLKEHMKLHSDTRDYIC 34
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1193
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.3
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.99
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.69
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.68
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.57
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.56
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.53
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.53
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.53
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.51
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.47
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.46
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.39
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.39
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.36
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.36
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.27
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.27
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.23
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.2
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.18
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.18
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.15
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.13
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.08
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.08
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.05
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 97.96
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.9
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.85
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.82
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.8
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.09
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.92
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.64
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.47
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.28
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.25
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.16
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.04
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.87
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.64
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.6
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.55
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.52
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.34
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.33
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.32
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 94.69
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.59
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.45
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.26
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.2
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.12
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.7
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.17
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 93.09
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 92.53
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 92.17
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 91.98
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.74
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.71
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 91.57
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 91.42
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.96
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 90.96
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.32
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 90.18
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 88.96
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 88.55
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.33
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.9
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 87.81
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.18
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 86.35
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.92
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.03
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 82.29
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 81.28
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.30  E-value=5.8e-13  Score=109.98  Aligned_cols=53  Identities=30%  Similarity=0.735  Sum_probs=50.8

Q ss_pred             CCCCCCCCCCCCccccChHHHHHHHhhhCCCCceecCCCCcCCcccChhhHHHhhhhh
Q 001000         1127 DRPLKCPWKGCKMTFKWAWARTEHIRVHTGARPYVCAEPGCGQTFRFVSDFSRHKRKT 1184 (1193)
Q Consensus      1127 EKPykCp~~eCGKtFs~kS~LkrH~RiHTGEKPYkC~epGCGKsFs~sSsL~rH~Rth 1184 (1193)
                      ||||.|  . ||++|.....|..|+++|+|++||.|.+  ||++|.+.+.|..|+++|
T Consensus         1 EK~y~C--~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC--Q-CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC--T-TSCEESSHHHHHHHHHHHSCCCSEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC--C-CCCeECCHHHhHHHhhccccccCCcCCC--cCCEecCHHHHHHHHhcC
Confidence            689999  6 9999999999999999999999999998  999999999999999984
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure