Query         001005
Match_columns 1192
No_of_seqs    159 out of 187
Neff          3.8 
Searched_HMMs 46136
Date          Thu Mar 28 13:08:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/001005.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/001005hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0196 Tyrosine kinase, EPH (  96.3  0.0035 7.6E-08   77.7   4.5   54  541-607   261-318 (996)
  2 PF07699 GCC2_GCC3:  GCC2 and G  96.2  0.0022 4.8E-08   53.9   1.7   26  550-577     9-34  (48)
  3 KOG0921 Dosage compensation co  95.0   0.049 1.1E-06   68.7   7.2   12  153-164   938-949 (1282)
  4 PF10256 Erf4:  Golgin subfamil  92.8    0.33 7.2E-06   47.6   7.1   67  714-780    21-91  (118)
  5 cd00185 TNFR Tumor necrosis fa  92.7    0.16 3.5E-06   48.6   4.7   65  538-609    12-87  (98)
  6 PF07562 NCD3G:  Nine Cysteines  92.7   0.026 5.6E-07   49.0  -0.6   36  540-577     6-51  (54)
  7 PHA02637 TNF-alpha-receptor-li  91.9    0.14 3.1E-06   51.9   3.4   57  542-603    31-92  (127)
  8 PHA02637 TNF-alpha-receptor-li  88.1    0.35 7.6E-06   49.3   2.6   41  534-575    38-87  (127)
  9 KOG0921 Dosage compensation co  85.0     1.7 3.6E-05   55.9   6.5   27   82-108   838-864 (1282)
 10 PF07699 GCC2_GCC3:  GCC2 and G  80.7     1.3 2.8E-05   37.5   2.4   30  538-567     9-43  (48)
 11 KOG3973 Uncharacterized conser  68.9      16 0.00035   43.0   7.9   16  168-184   225-240 (465)
 12 cd00185 TNFR Tumor necrosis fa  65.5     6.6 0.00014   37.7   3.5   31  549-579    11-43  (98)
 13 PF15496 DUF4646:  Domain of un  61.8     7.7 0.00017   39.3   3.3   22  865-886    46-67  (123)
 14 KOG4289 Cadherin EGF LAG seven  58.3     7.2 0.00016   52.3   2.9   86 1031-1128 2169-2256(2531)
 15 KOG4069 Uncharacterized conser  54.3      40 0.00088   35.1   6.8   70  713-786    45-125 (154)
 16 smart00180 EGF_Lam Laminin-typ  54.1     7.6 0.00016   32.8   1.5   24  535-561    17-40  (46)
 17 PF05268 GP38:  Phage tail fibr  53.9      25 0.00055   39.3   5.7   27  399-427   125-151 (260)
 18 cd00055 EGF_Lam Laminin-type e  53.3     7.8 0.00017   33.1   1.5   27  534-563    17-43  (50)
 19 KOG3973 Uncharacterized conser  52.2      52  0.0011   39.1   8.1    8   94-101   152-159 (465)
 20 PTZ00146 fibrillarin; Provisio  51.3      34 0.00073   39.7   6.5   10  423-432    64-73  (293)
 21 PF10256 Erf4:  Golgin subfamil  50.8      23 0.00051   34.9   4.5   65  862-930    26-115 (118)
 22 PF07354 Sp38:  Zona-pellucida-  45.3      13 0.00029   42.3   2.1   36  538-576   217-261 (271)
 23 PF00053 Laminin_EGF:  Laminin   39.2      13 0.00028   31.4   0.6   21  543-563    22-42  (49)
 24 KOG1836 Extracellular matrix g  39.0      24 0.00052   49.1   3.3   34  541-575   697-732 (1705)
 25 PF12273 RCR:  Chitin synthesis  37.8      30 0.00064   35.0   3.1   20  626-645     2-22  (130)
 26 KOG1836 Extracellular matrix g  36.7      24 0.00052   49.1   2.9   43  535-577   794-838 (1705)
 27 PF11145 DUF2921:  Protein of u  33.3 1.1E+02  0.0023   40.8   7.6  116 1004-1119  593-723 (909)
 28 cd00064 FU Furin-like repeats.  31.1      29 0.00064   29.1   1.5   22  541-562    18-42  (49)
 29 KOG0994 Extracellular matrix g  30.1      51  0.0011   44.2   4.0   40  542-585   785-824 (1758)
 30 KOG4260 Uncharacterized conser  28.8      36 0.00078   39.3   2.2   21  542-562   131-151 (350)
 31 PF05268 GP38:  Phage tail fibr  28.8      91   0.002   35.2   5.1   14  468-481   143-156 (260)
 32 PTZ00382 Variant-specific surf  27.4      44 0.00095   32.8   2.2   25  550-577     4-28  (96)
 33 COG4907 Predicted membrane pro  26.3      43 0.00093   41.0   2.3    8  295-302   451-458 (595)
 34 COG1512 Beta-propeller domains  25.0      71  0.0015   36.8   3.7   12  356-367   257-268 (271)
 35 KOG4260 Uncharacterized conser  24.4      43 0.00092   38.7   1.7   36  541-576   170-205 (350)
 36 KOG4180 Predicted kinase [Gene  23.4 1.3E+02  0.0028   35.8   5.3   28  823-851    96-123 (395)
 37 PF14946 DUF4501:  Domain of un  23.1 2.3E+02  0.0049   30.9   6.6   29  621-649    83-112 (180)
 38 KOG4289 Cadherin EGF LAG seven  22.4      84  0.0018   43.3   3.9   36  532-575  1734-1774(2531)
 39 KOG3915 Transcription regulato  22.1 1.2E+02  0.0026   37.4   4.8    9  846-855   488-496 (641)
 40 PF04790 Sarcoglycan_1:  Sarcog  21.4 8.8E+02   0.019   28.0  11.3   59  280-340   162-222 (264)
 41 PF15496 DUF4646:  Domain of un  20.8 1.2E+02  0.0025   31.0   3.9   70  719-789    43-120 (123)

No 1  
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]
Probab=96.30  E-value=0.0035  Score=77.73  Aligned_cols=54  Identities=39%  Similarity=0.883  Sum_probs=39.9

Q ss_pred             cCCCCCCC----cccceeCCCCccccccCCCCCCcccCCCCCCCCCceEEeeeCCccCCCCCccccCCccc
Q 001005          541 KACPKGLY----GIFCEECPVGTYKNVTGSDKSLCHQCPPQEFPHRAVYISVRGGIAETPCPYRCISERYH  607 (1192)
Q Consensus       541 k~CP~G~y----G~fC~eCP~GtYK~~tGs~~~~C~pCp~~~~P~ra~yiyvr~G~~~~~CpY~C~sdk~~  607 (1192)
                      =-|.+||.    |.-|+.||.||||...|  ...|.+||.+...+       ..  ..++|.  |..++|+
T Consensus       261 C~C~aGye~~~~~~~C~aCp~G~yK~~~~--~~~C~~CP~~S~s~-------~e--ga~~C~--C~~gyyR  318 (996)
T KOG0196|consen  261 CVCKAGYEEAENGKACQACPPGTYKASQG--DSLCLPCPPNSHSS-------SE--GATSCT--CENGYYR  318 (996)
T ss_pred             eeecCCCCcccCCCcceeCCCCcccCCCC--CCCCCCCCCCCCCC-------CC--CCCccc--ccCCccc
Confidence            46899984    77799999999999764  57899999854221       11  246775  8888775


No 2  
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=96.25  E-value=0.0022  Score=53.91  Aligned_cols=26  Identities=42%  Similarity=1.095  Sum_probs=22.6

Q ss_pred             ccceeCCCCccccccCCCCCCcccCCCC
Q 001005          550 IFCEECPVGTYKNVTGSDKSLCHQCPPQ  577 (1192)
Q Consensus       550 ~fC~eCP~GtYK~~tGs~~~~C~pCp~~  577 (1192)
                      .-|++||.||||+..|.  ..|.+||..
T Consensus         9 ~~C~~Cp~GtYq~~~g~--~~C~~Cp~g   34 (48)
T PF07699_consen    9 NKCQPCPKGTYQDEEGQ--TSCTPCPPG   34 (48)
T ss_pred             CccCCCCCCccCCccCC--ccCccCcCC
Confidence            45999999999999876  479999975


No 3  
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=94.97  E-value=0.049  Score=68.67  Aligned_cols=12  Identities=33%  Similarity=0.570  Sum_probs=7.6

Q ss_pred             hhhccccceeee
Q 001005          153 EELLMSDSVIKV  164 (1192)
Q Consensus       153 ~~~lm~~s~ikv  164 (1192)
                      |..-.++++.|+
T Consensus       938 ~r~~l~~~~~~~  949 (1282)
T KOG0921|consen  938 ERYSLSNPVLKM  949 (1282)
T ss_pred             Hhhhhcchhhhh
Confidence            445667777665


No 4  
>PF10256 Erf4:  Golgin subfamily A member 7/ERF4 family;  InterPro: IPR019383 Proteins in this entry include Golgin subfamily A member 7 and the Ras modification protein ERF4. 
Probab=92.78  E-value=0.33  Score=47.65  Aligned_cols=67  Identities=22%  Similarity=0.341  Sum_probs=45.7

Q ss_pred             CCcchhhhhhchHHHHHHHHHHHhhhhhh--h--hhhHHHHHhHHhhcchhHHHHHHHHHHHHHHHHHHHH
Q 001005          714 TPPEQIKEIVYEGAFNSFVDEINAIATYH--W--WEGAIYSILAILAYPLAWSWQQWRRRMKLQRLREYVR  780 (1192)
Q Consensus       714 spP~~i~~iVyed~Fn~Fad~IN~laay~--~--We~~iy~iLsvl~YPlaw~~lq~rRrkk~~rL~efv~  780 (1192)
                      .-|.++...+.+++|++++++||+..+=.  .  |.-++-.+|.++..=+...+.....||++++|.+|+.
T Consensus        21 ~~P~~L~~~is~~ef~~iI~~IN~~l~~a~~~~~~~~~~~~~l~~lt~~l~~~~~~~~~~~~~~~le~~l~   91 (118)
T PF10256_consen   21 EYPGELSGYISPEEFEEIINTINQILKEAFEPISWRNIIENILGCLTLGLSSLCFKTHYKRKLRELEKYLE   91 (118)
T ss_pred             cCCHhhcCCCCHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46778999999999999999999987322  2  4444555555554222222234556677888999996


No 5  
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and organogenesis. TNFRs domains are elongated with generally three tandem repeats of cysteine-rich domains (CRDs). They fit in the grooves between protomers within the ligand trimer. Some TNFRs, such as NGFR and HveA, bind ligands with no structural similarity to TNF and do not bind ligand trimers.
Probab=92.73  E-value=0.16  Score=48.55  Aligned_cols=65  Identities=28%  Similarity=0.568  Sum_probs=42.1

Q ss_pred             EEccCCCCCCC---------cccceeCCCCccccccCCCCCCcccCCCCCCCCCceEEeeeCCcc--CCCCCccccCCcc
Q 001005          538 TTGKACPKGLY---------GIFCEECPVGTYKNVTGSDKSLCHQCPPQEFPHRAVYISVRGGIA--ETPCPYRCISERY  606 (1192)
Q Consensus       538 I~gk~CP~G~y---------G~fC~eCP~GtYK~~tGs~~~~C~pCp~~~~P~ra~yiyvr~G~~--~~~CpY~C~sdk~  606 (1192)
                      .-=+.||+|++         ..-|++||.|+|...... ...|++|..  -+ ...++ ++.+..  .+.|-  |.+++|
T Consensus        12 ~cC~~C~pG~~~~~~C~~~~~t~C~~C~~g~ys~~~~~-~~~C~~c~~--C~-~g~~~-~~~ct~t~dt~C~--C~~G~y   84 (98)
T cd00185          12 LCCDQCPPGTYLSKDCTPGSDTVCEPCPPGTYTDSWNH-LPKCLSCRT--CD-SGLVE-KAPCTATRNTVCG--CKPGFY   84 (98)
T ss_pred             CCCCCCCCCccCCCcCCCCCCCeecCCCCCCcccCCCC-CCcCCcCcc--CC-CCCEE-EccCCCCCCCeEe--CCCCCE
Confidence            44578999985         356999999999986532 257999975  44 22233 323322  46685  888777


Q ss_pred             cCC
Q 001005          607 HMP  609 (1192)
Q Consensus       607 ~~p  609 (1192)
                      ...
T Consensus        85 ~~~   87 (98)
T cd00185          85 CLT   87 (98)
T ss_pred             ecC
Confidence            544


No 6  
>PF07562 NCD3G:  Nine Cysteines Domain of family 3 GPCR;  InterPro: IPR011500 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  GPCR family 3 receptors (also known as family C) are structurally similar to other GPCRs, but do not show any significant sequence similarity and thus represent a distinct group. Structurally they are composed of four elements; an N-terminal signal sequence; a large hydrophilic extracellular agonist-binding region containing several conserved cysteine residues which could be involved in disulphide bonds; a shorter region containing seven transmembrane domains; and a C-terminal cytoplasmic domain of variable length []. Family 3 members include the metabotropic glutamate receptors, the extracellular calcium-sensing receptors, the gamma-amino-butyric acid (GABA) type B receptors, and the vomeronasal type-2 receptors [, , , ]. As these receptors regulate many important physiological processes they are potentially promising targets for drug development. This entry represents a conserved sequence, found in the extracellular region, that contains several highly-conserved Cys residues that are predicted to form disulphide bridges.; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 2E4X_B 2E4Y_A 2E4U_B 2E4V_B 2E4W_A.
Probab=92.68  E-value=0.026  Score=49.05  Aligned_cols=36  Identities=36%  Similarity=0.812  Sum_probs=19.9

Q ss_pred             ccCCCCCCCc----------ccceeCCCCccccccCCCCCCcccCCCC
Q 001005          540 GKACPKGLYG----------IFCEECPVGTYKNVTGSDKSLCHQCPPQ  577 (1192)
Q Consensus       540 gk~CP~G~yG----------~fC~eCP~GtYK~~tGs~~~~C~pCp~~  577 (1192)
                      ..+|++|++.          +-|++||.|+|.+.+  +...|.+||.+
T Consensus         6 S~~C~pG~~k~~~~~~~~CCw~C~~C~~~~is~~~--~~~~C~~C~~~   51 (54)
T PF07562_consen    6 SEPCPPGQRKKIQKGQPSCCWDCVPCPEGEISNQT--DSTSCTKCPEG   51 (54)
T ss_dssp             S----TTTEEEE--SSS-S--EEEE--TTEEEE----ETTEEEE--TT
T ss_pred             CCCCCCCCEECccCCCcceEEEeecCCCCcEECCC--CccccccCCCc
Confidence            4689999852          239999999999987  44689999974


No 7  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=91.86  E-value=0.14  Score=51.95  Aligned_cols=57  Identities=26%  Similarity=0.596  Sum_probs=37.4

Q ss_pred             CCCCCCC---cccceeCCCCccccccCC--CCCCcccCCCCCCCCCceEEeeeCCccCCCCCccccC
Q 001005          542 ACPKGLY---GIFCEECPVGTYKNVTGS--DKSLCHQCPPQEFPHRAVYISVRGGIAETPCPYRCIS  603 (1192)
Q Consensus       542 ~CP~G~y---G~fC~eCP~GtYK~~tGs--~~~~C~pCp~~~~P~ra~yiyvr~G~~~~~CpY~C~s  603 (1192)
                      .|..+-|   +.-|.+||.|+|.....+  ....|.|||..+.....++..     ....|.-.|++
T Consensus        31 ~C~e~EY~~~~~CC~kCPPGt~v~~~Ct~~t~T~C~PCp~GTYTe~~N~~~-----~C~~C~~~Cd~   92 (127)
T PHA02637         31 KCKDNEYKRHNLCCLSCPPGTYASRLCDIKTNTQCTPCGSGTFTSHNNHLP-----ACLSCNGRCDR   92 (127)
T ss_pred             CCCCCcCcCCCeEcCCCCCCCEEeCcCCCCCCcccccCCCCCeeccCCCCC-----cccccCCccCc
Confidence            6888865   445999999999874433  235799999876444333321     25677777776


No 8  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=88.11  E-value=0.35  Score=49.26  Aligned_cols=41  Identities=24%  Similarity=0.617  Sum_probs=31.0

Q ss_pred             CCceEEccCCCCCCC---------cccceeCCCCccccccCCCCCCcccCC
Q 001005          534 ENGTTTGKACPKGLY---------GIFCEECPVGTYKNVTGSDKSLCHQCP  575 (1192)
Q Consensus       534 ~~GTI~gk~CP~G~y---------G~fC~eCP~GtYK~~tGs~~~~C~pCp  575 (1192)
                      ..|..-=+.||||++         ..-|.+||.|||...... ...|.+|.
T Consensus        38 ~~~~~CC~kCPPGt~v~~~Ct~~t~T~C~PCp~GTYTe~~N~-~~~C~~C~   87 (127)
T PHA02637         38 KRHNLCCLSCPPGTYASRLCDIKTNTQCTPCGSGTFTSHNNH-LPACLSCN   87 (127)
T ss_pred             cCCCeEcCCCCCCCEEeCcCCCCCCcccccCCCCCeeccCCC-CCcccccC
Confidence            445667789999985         667999999999875432 34688887


No 9  
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=84.97  E-value=1.7  Score=55.88  Aligned_cols=27  Identities=15%  Similarity=0.207  Sum_probs=14.1

Q ss_pred             cCccccccceeeccCCCCCcceeEEEe
Q 001005           82 NYNMSTDTETLLLEFPNQPLWTNVYVQ  108 (1192)
Q Consensus        82 n~n~~t~t~t~ll~fp~~~lw~~v~~~  108 (1192)
                      +|-..|.-...|+.-|-.|+-..++|-
T Consensus       838 ~n~elt~lg~~la~l~iep~~~k~~~l  864 (1282)
T KOG0921|consen  838 ANDELTPLGRMLARLPIEPRIGKMMIL  864 (1282)
T ss_pred             ccCcccchhhhhhhccCcccccceeee
Confidence            344444444455566666665555544


No 10 
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=80.70  E-value=1.3  Score=37.48  Aligned_cols=30  Identities=40%  Similarity=0.912  Sum_probs=24.0

Q ss_pred             EEccCCCCCCC----c-ccceeCCCCccccccCCC
Q 001005          538 TTGKACPKGLY----G-IFCEECPVGTYKNVTGSD  567 (1192)
Q Consensus       538 I~gk~CP~G~y----G-~fC~eCP~GtYK~~tGs~  567 (1192)
                      -.=.+||.|+|    | ..|.+||.|+|....|+.
T Consensus         9 ~~C~~Cp~GtYq~~~g~~~C~~Cp~g~~T~~~Gs~   43 (48)
T PF07699_consen    9 NKCQPCPKGTYQDEEGQTSCTPCPPGSTTSSEGST   43 (48)
T ss_pred             CccCCCCCCccCCccCCccCccCcCCCccCCcCCc
Confidence            44579999987    3 459999999998877764


No 11 
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=68.89  E-value=16  Score=42.99  Aligned_cols=16  Identities=25%  Similarity=0.771  Sum_probs=8.7

Q ss_pred             hhhhhhhheeecceEEE
Q 001005          168 LRMTVKIFLMWNSEMLV  184 (1192)
Q Consensus       168 l~~~~~~~lm~~s~~~i  184 (1192)
                      |.+||.- ..||-+|.-
T Consensus       225 L~vTVqS-F~Wsdr~k~  240 (465)
T KOG3973|consen  225 LKVTVQS-FLWSDRLKM  240 (465)
T ss_pred             HHHHHHh-hcccHHHHH
Confidence            5556655 356665543


No 12 
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and organogenesis. TNFRs domains are elongated with generally three tandem repeats of cysteine-rich domains (CRDs). They fit in the grooves between protomers within the ligand trimer. Some TNFRs, such as NGFR and HveA, bind ligands with no structural similarity to TNF and do not bind ligand trimers.
Probab=65.48  E-value=6.6  Score=37.73  Aligned_cols=31  Identities=35%  Similarity=1.096  Sum_probs=23.2

Q ss_pred             cccceeCCCCccccccCC--CCCCcccCCCCCC
Q 001005          549 GIFCEECPVGTYKNVTGS--DKSLCHQCPPQEF  579 (1192)
Q Consensus       549 G~fC~eCP~GtYK~~tGs--~~~~C~pCp~~~~  579 (1192)
                      +.-|..||.|+|-...+.  ....|.+|+..++
T Consensus        11 ~~cC~~C~pG~~~~~~C~~~~~t~C~~C~~g~y   43 (98)
T cd00185          11 GLCCDQCPPGTYLSKDCTPGSDTVCEPCPPGTY   43 (98)
T ss_pred             CCCCCCCCCCccCCCcCCCCCCCeecCCCCCCc
Confidence            555999999999876532  2357999998654


No 13 
>PF15496 DUF4646:  Domain of unknown function (DUF4646)
Probab=61.81  E-value=7.7  Score=39.29  Aligned_cols=22  Identities=18%  Similarity=0.096  Sum_probs=18.2

Q ss_pred             cCChHHHHHHHHHHHHHHHHhh
Q 001005          865 LVPPTICYRLVAGLNAQLRLVR  886 (1192)
Q Consensus       865 ~~~~~~w~~fVa~lN~qlR~v~  886 (1192)
                      .|..+.|.+|+.+|+...++-.
T Consensus        46 DVs~eDW~~F~~dl~~aa~ls~   67 (123)
T PF15496_consen   46 DVSEEDWTRFLNDLSEAASLSP   67 (123)
T ss_pred             CCCHHHHHHHHHHHHHHHhcCc
Confidence            6899999999999999844433


No 14 
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]
Probab=58.29  E-value=7.2  Score=52.30  Aligned_cols=86  Identities=24%  Similarity=0.194  Sum_probs=50.3

Q ss_pred             hhhhHHHHHHHHHHhhHHHHHHHHHHHHHhhhhhHHHH-HHhccccccccccchhhhhhccCCCCcc-cccchhhhhhhh
Q 001005         1031 HQDLVGLVISVLLLGDFSLVLLTLLQLYSISLVDVFLV-LFILPLGILLPFPAGINALFSHGPRRSV-GLARVYALWNVT 1108 (1192)
Q Consensus      1031 ~~~l~~l~is~lll~D~~ltll~llq~y~is~~~~~~v-l~~lPl~~~~p~~~Gl~alfs~~~rrs~-~~ar~yalwN~~ 1108 (1192)
                      -+..+|+.+..|+|+=+.++++-+|---+.+|...+++ |++          +-|  +|+||.-+.. -+.-+-+|--.+
T Consensus      2169 t~a~~gvslaal~lt~~llls~RsLksn~~~I~~~l~~Al~l----------~~L--~Fv~gi~~nq~~CtvvailLhf~ 2236 (2531)
T KOG4289|consen 2169 TYAAVGVSLAALLLTFLLLLSLRSLKSNSHGIHFNLAAALGL----------AQL--VFVLGINQNQFYCTVVAILLHFT 2236 (2531)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhhHHHHHHhH----------HHH--HhhhhcccCchhhHHHHHHHHHH
Confidence            34566666666776666666666665555666533322 222          222  6666665542 233444566667


Q ss_pred             hhhHHHHHhhhhcccccCCC
Q 001005         1109 SLINVGVAFLCGYVHYSSGS 1128 (1192)
Q Consensus      1109 Sl~n~~va~icg~~~~~~~~ 1128 (1192)
                      ++.-..=+|+.|+--|-|-.
T Consensus      2237 ~~stFaWlfl~gLhlYRml~ 2256 (2531)
T KOG4289|consen 2237 YLSTFAWLFLEGLHLYRMLT 2256 (2531)
T ss_pred             HhhhHHHHHHHHHHHHHHHh
Confidence            77777778888887776544


No 15 
>KOG4069 consensus Uncharacterized conserved protein [Function unknown]
Probab=54.26  E-value=40  Score=35.12  Aligned_cols=70  Identities=20%  Similarity=0.397  Sum_probs=50.2

Q ss_pred             CCCcchhhhhhchHHHHHHHHHHHhhhhh-------hhhhhHHHHHhHHhhcchhHHHHHHHHHHHHHHHHHHHHhh---
Q 001005          713 HTPPEQIKEIVYEGAFNSFVDEINAIATY-------HWWEGAIYSILAILAYPLAWSWQQWRRRMKLQRLREYVRSE---  782 (1192)
Q Consensus       713 ~spP~~i~~iVyed~Fn~Fad~IN~laay-------~~We~~iy~iLsvl~YPlaw~~lq~rRrkk~~rL~efv~se---  782 (1192)
                      ...|..+++.|..+.|+.=+..+|++-|=       ..+|+.+   =++.+|-.|.--.. -=+||+++++||+.++   
T Consensus        45 ~~~pa~le~~i~R~vfE~Ti~rlN~~yAeAE~~~~qty~Egcl---gC~TaY~iy~ctet-hYek~L~klskfl~~qNe~  120 (154)
T KOG4069|consen   45 AEYPARLEEKIPRDVFENTIVRLNRIYAEAEAITPQTYFEGCL---GCFTAYAIYACTET-HYEKKLDKLSKFLNRQNEE  120 (154)
T ss_pred             ecCcHHHhccCcHHHHHHHHHHHHHHHHHHHhcCCcchHHHHH---HHHHHHHHHHHHHH-HHHHHHHHHHHHHHhhhhh
Confidence            34789999999999999999999998432       2466664   56666665543332 3357899999999843   


Q ss_pred             -cCch
Q 001005          783 -YDHA  786 (1192)
Q Consensus       783 -ydh~  786 (1192)
                       |.|.
T Consensus       121 IY~~~  125 (154)
T KOG4069|consen  121 IYHHV  125 (154)
T ss_pred             hcccc
Confidence             6664


No 16 
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai.
Probab=54.12  E-value=7.6  Score=32.80  Aligned_cols=24  Identities=29%  Similarity=0.753  Sum_probs=20.0

Q ss_pred             CceEEccCCCCCCCcccceeCCCCccc
Q 001005          535 NGTTTGKACPKGLYGIFCEECPVGTYK  561 (1192)
Q Consensus       535 ~GTI~gk~CP~G~yG~fC~eCP~GtYK  561 (1192)
                      .|.-   .|++++.|..|++|+.|+|-
T Consensus        17 ~G~C---~C~~~~~G~~C~~C~~g~~g   40 (46)
T smart00180       17 TGQC---ECKPNVTGRRCDRCAPGYYG   40 (46)
T ss_pred             CCEE---ECCCCCCCCCCCcCCCCcCC
Confidence            4544   39999999999999999995


No 17 
>PF05268 GP38:  Phage tail fibre adhesin Gp38;  InterPro: IPR007932 This entry is represented by Bacteriophage T2, Gp38. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family contains several Gp38 proteins from T-even-like phages. Gp38, together with a second phage protein, Gp57, catalyses the organisation of Gp37 but is absent from the phage particle. Gp37 is responsible for receptor recognition [].
Probab=53.86  E-value=25  Score=39.31  Aligned_cols=27  Identities=22%  Similarity=0.299  Sum_probs=13.9

Q ss_pred             CCCCCCCccEEEEeeccCCcceeEeeeEE
Q 001005          399 SGNSTAGGGIIVMGSFEHPLSSLSVEGSV  427 (1192)
Q Consensus       399 ~~~GGaGGGiI~I~A~~~~L~~L~l~GsI  427 (1192)
                      ...|++||=+|+=.... .| +|..+|.|
T Consensus       125 ~~~g~~GG~~I~N~iG~-rL-RI~N~GaI  151 (260)
T PF05268_consen  125 NSAGAAGGHAIQNDIGG-RL-RINNNGAI  151 (260)
T ss_pred             CCCccccceeeecCCcc-eE-EEecCCEE
Confidence            34566777777633221 22 34555555


No 18 
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies
Probab=53.31  E-value=7.8  Score=33.05  Aligned_cols=27  Identities=26%  Similarity=0.562  Sum_probs=22.0

Q ss_pred             CCceEEccCCCCCCCcccceeCCCCccccc
Q 001005          534 ENGTTTGKACPKGLYGIFCEECPVGTYKNV  563 (1192)
Q Consensus       534 ~~GTI~gk~CP~G~yG~fC~eCP~GtYK~~  563 (1192)
                      .+|+-   .|++|+.|..|++|+.|+|...
T Consensus        17 ~~G~C---~C~~~~~G~~C~~C~~g~~~~~   43 (50)
T cd00055          17 GTGQC---ECKPNTTGRRCDRCAPGYYGLP   43 (50)
T ss_pred             CCCEE---eCCCcCCCCCCCCCCCCCccCC
Confidence            45555   3999999999999999999653


No 19 
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=52.17  E-value=52  Score=39.09  Aligned_cols=8  Identities=63%  Similarity=1.090  Sum_probs=4.2

Q ss_pred             ccCCCCCc
Q 001005           94 LEFPNQPL  101 (1192)
Q Consensus        94 l~fp~~~l  101 (1192)
                      |.||.+|-
T Consensus       152 L~~~k~p~  159 (465)
T KOG3973|consen  152 LNFPKQPG  159 (465)
T ss_pred             cCCCCCCC
Confidence            44565553


No 20 
>PTZ00146 fibrillarin; Provisional
Probab=51.27  E-value=34  Score=39.66  Aligned_cols=10  Identities=30%  Similarity=0.474  Sum_probs=6.5

Q ss_pred             eeeEEEeCCC
Q 001005          423 VEGSVKADGQ  432 (1192)
Q Consensus       423 l~GsI~AnGg  432 (1192)
                      ..|...+.|.
T Consensus        64 ~~gv~~~~~~   73 (293)
T PTZ00146         64 FPGVFIAKGK   73 (293)
T ss_pred             ecCEEEeecC
Confidence            4677777664


No 21 
>PF10256 Erf4:  Golgin subfamily A member 7/ERF4 family;  InterPro: IPR019383 Proteins in this entry include Golgin subfamily A member 7 and the Ras modification protein ERF4. 
Probab=50.76  E-value=23  Score=34.90  Aligned_cols=65  Identities=15%  Similarity=0.322  Sum_probs=44.9

Q ss_pred             hcccCChHHHHHHHHHHHHHHHHh-hcc------------------------ccchhhHhHHHHHhhcCCCccccCCeEE
Q 001005          862 MSQLVPPTICYRLVAGLNAQLRLV-RRG------------------------RLRATFRPVLRWLETHANPTLQLHGLRV  916 (1192)
Q Consensus       862 ~~q~~~~~~w~~fVa~lN~qlR~v-~~~------------------------slr~tl~~vi~~lesh~n~~l~~~Gvrv  916 (1192)
                      ++..+++++|+++|.+||..++.. ..-                        .-+..+..+=+||+..|++.++.+|+++
T Consensus        26 L~~~is~~ef~~iI~~IN~~l~~a~~~~~~~~~~~~~l~~lt~~l~~~~~~~~~~~~~~~le~~l~~~N~~~~~~~gi~i  105 (118)
T PF10256_consen   26 LSGYISPEEFEEIINTINQILKEAFEPISWRNIIENILGCLTLGLSSLCFKTHYKRKLRELEKYLEQLNEELFKPRGIKI  105 (118)
T ss_pred             hcCCCCHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCcEE
Confidence            455789999999999999998877 321                        1122344466788888887899999854


Q ss_pred             EEEEEEEeceeeEE
Q 001005          917 DLAWFQATACGYCQ  930 (1192)
Q Consensus       917 ~L~~fqata~g~~q  930 (1192)
                      -    -.-.+||-.
T Consensus       106 i----~pr~~g~ls  115 (118)
T PF10256_consen  106 I----SPRRSGYLS  115 (118)
T ss_pred             E----chhHceEEE
Confidence            3    233555543


No 22 
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=45.25  E-value=13  Score=42.33  Aligned_cols=36  Identities=28%  Similarity=0.574  Sum_probs=27.3

Q ss_pred             EEccCCCCCCC---------cccceeCCCCccccccCCCCCCcccCCC
Q 001005          538 TTGKACPKGLY---------GIFCEECPVGTYKNVTGSDKSLCHQCPP  576 (1192)
Q Consensus       538 I~gk~CP~G~y---------G~fC~eCP~GtYK~~tGs~~~~C~pCp~  576 (1192)
                      +.=..|+|||+         -.=|+-|++|||....+   ..|+.|+.
T Consensus       217 v~idsC~PGfG~N~~~h~~C~~CCVvCsPgTysp~~~---~~C~~C~~  261 (271)
T PF07354_consen  217 VRIDSCRPGFGKNDILHSDCPSCCVVCSPGTYSPDDD---VHCQQCNS  261 (271)
T ss_pred             EEeeccCCCCCcCcccCCCCCCeeEECCCcccCCCCC---ceEEecCc
Confidence            34467888886         12499999999987654   58999996


No 23 
>PF00053 Laminin_EGF:  Laminin EGF-like (Domains III and V);  InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation. They are composed of distinct but related alpha, beta and gamma chains. The three chains form a cross-shaped molecule that consist of a long arm and three short globular arms. The long arm consist of a coiled coil structure contributed by all three chains and cross-linked by interchain disulphide bonds. Beside different types of globular domains each subunit contains, in its first half, consecutive repeats of about 60 amino acids in length that include eight conserved cysteines []. The tertiary structure [, ] of this domain is remotely similar in its N-terminal to that of the EGF-like module (see PDOC00021 from PROSITEDOC). It is known as a 'LE' or 'laminin-type EGF-like' domain. The number of copies of the LE domain in the different forms of laminins is highly variable; from 3 up to 22 copies have been found. A schematic representation of the topology of the four disulphide bonds in the LE domain is shown below.  +-------------------+ +-|-----------+ | +--------+ +-----------------+ | | | | | | | | xxCxCxxxxxxxxxxxCxxxxxxxCxxCxxxxxGxxCxxCxxgaagxxxxxxxxxxxCxx sssssssssssssssssssssssssssssssssss 'C': conserved cysteine involved in a disulphide bond 'a': conserved aromatic residue 'G': conserved glycine (lower case = less conserved) 's': region similar to the EGF-like domain  In mouse laminin gamma-1 chain, the seventh LE domain has been shown to be the only one that binds with a high affinity to nidogen []. The binding-sites are located on the surface within the loops C1-C3 and C5-C6 [, ]. Long consecutive arrays of LE domains in laminins form rod-like elements of limited flexibility [], which determine the spacing in the formation of laminin networks of basement membranes [].; PDB: 3TBD_A 3ZYG_B 3ZYI_B 2Y38_A 1KLO_A 1NPE_B 3ZYJ_B 1TLE_A.
Probab=39.22  E-value=13  Score=31.38  Aligned_cols=21  Identities=29%  Similarity=0.689  Sum_probs=17.4

Q ss_pred             CCCCCCcccceeCCCCccccc
Q 001005          543 CPKGLYGIFCEECPVGTYKNV  563 (1192)
Q Consensus       543 CP~G~yG~fC~eCP~GtYK~~  563 (1192)
                      |++++.|..|++|..|+|...
T Consensus        22 C~~~~~G~~C~~C~~g~~~~~   42 (49)
T PF00053_consen   22 CKPGTTGPRCDQCKPGYFGLP   42 (49)
T ss_dssp             BSTTEESTTS-EE-TTEECST
T ss_pred             ccccccCCcCcCCCCcccccc
Confidence            999999999999999999764


No 24 
>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures]
Probab=38.96  E-value=24  Score=49.12  Aligned_cols=34  Identities=32%  Similarity=0.708  Sum_probs=25.6

Q ss_pred             cCCCCCCCcccceeCCCCccccccCCCCC--CcccCC
Q 001005          541 KACPKGLYGIFCEECPVGTYKNVTGSDKS--LCHQCP  575 (1192)
Q Consensus       541 k~CP~G~yG~fC~eCP~GtYK~~tGs~~~--~C~pCp  575 (1192)
                      =.||+||-|-||+.|+.|+.+. +.....  .|.+|+
T Consensus       697 c~C~~g~tG~~Ce~C~~gfrr~-~~~~~~~~~c~~C~  732 (1705)
T KOG1836|consen  697 CTCPVGYTGQFCESCAPGFRRL-SPQLGPFCPCIPCD  732 (1705)
T ss_pred             ccCCCCcccchhhhcchhhhcc-cccCCCCCcccccc
Confidence            5799999999999999999665 344444  455555


No 25 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=37.81  E-value=30  Score=34.99  Aligned_cols=20  Identities=35%  Similarity=0.891  Sum_probs=9.5

Q ss_pred             h-hhHHHHHHHHHHHHHHHHH
Q 001005          626 W-LFCLLLVGLLILLALVLSV  645 (1192)
Q Consensus       626 ~-~F~lll~~llvLlalv~s~  645 (1192)
                      | +|+||+++++++|+++..+
T Consensus         2 W~l~~iii~~i~l~~~~~~~~   22 (130)
T PF12273_consen    2 WVLFAIIIVAILLFLFLFYCH   22 (130)
T ss_pred             eeeHHHHHHHHHHHHHHHHHH
Confidence            5 4555554444444444433


No 26 
>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures]
Probab=36.72  E-value=24  Score=49.06  Aligned_cols=43  Identities=35%  Similarity=0.688  Sum_probs=34.7

Q ss_pred             CceEEccCCCCCCCcccceeCCCCccccccCCC--CCCcccCCCC
Q 001005          535 NGTTTGKACPKGLYGIFCEECPVGTYKNVTGSD--KSLCHQCPPQ  577 (1192)
Q Consensus       535 ~GTI~gk~CP~G~yG~fC~eCP~GtYK~~tGs~--~~~C~pCp~~  577 (1192)
                      ..++.-|.||+||.|..|++|.-|+|=+..+-+  ...|++|+-+
T Consensus       794 ~~~~iCk~Cp~gytG~rCe~c~dgyfg~p~~~~~~~~~c~~c~c~  838 (1705)
T KOG1836|consen  794 ILEVVCKNCPPGYTGLRCEECADGYFGNPLGHDGDVRPCQSCQCN  838 (1705)
T ss_pred             ccceecCCCCCCCcccccccCCCccccCCCCCCCCcccCccceec
Confidence            456667899999999999999999998865432  2489999964


No 27 
>PF11145 DUF2921:  Protein of unknown function (DUF2921);  InterPro: IPR021319  This eukaryotic family of proteins has no known function. 
Probab=33.30  E-value=1.1e+02  Score=40.77  Aligned_cols=116  Identities=18%  Similarity=0.171  Sum_probs=65.5

Q ss_pred             Ccccccccccceee--eeeeeeecCccc-chhhhHH---HHHHHHHHhhHHHHHHHHHHHHHhhhh------hHHHHHHh
Q 001005         1004 NNVQMLEERRDIFY--FLSFIVHNTKPV-GHQDLVG---LVISVLLLGDFSLVLLTLLQLYSISLV------DVFLVLFI 1071 (1192)
Q Consensus      1004 ~~l~~le~~r~~~~--p~s~~l~n~rp~-g~~~l~~---l~is~lll~D~~ltll~llq~y~is~~------~~~~vl~~ 1071 (1192)
                      .+++++.++=|++|  |+.+-....-.- ...+.+.   +=+.+.++.=......+.+|++-+.=.      -=+.||.+
T Consensus       593 g~I~S~R~~~DpL~F~~~~l~~~~~~~~~q~~~~i~R~d~E~i~~~~s~tl~~~~~~~QL~~~k~~~~~~P~iSlvML~v  672 (909)
T PF11145_consen  593 GSISSTRDKSDPLYFEPLDLSTYPIYYRKQAEESIWRMDLEGIMRVISLTLSCVFIGLQLFHVKKHPDVLPYISLVMLGV  672 (909)
T ss_pred             EEEEeccCCCCCccccceeeeeccceeccccchhhhhhhHHHHHHHHHHHHHHHHHHHHHhhhhcCCCccchHhHHHHHH
Confidence            36677778888888  665544333111 2233332   111111111122334577898652210      12458888


Q ss_pred             ccccccccccchhhhhhcc-CCCCcccccchhhhhhhhhhhH--HHHHhhh
Q 001005         1072 LPLGILLPFPAGINALFSH-GPRRSVGLARVYALWNVTSLIN--VGVAFLC 1119 (1192)
Q Consensus      1072 lPl~~~~p~~~Gl~alfs~-~~rrs~~~ar~yalwN~~Sl~n--~~va~ic 1119 (1192)
                      +=|+-.+|..++.-|||.. ..++...+.+-=-+|..-.++-  ++|||+.
T Consensus       673 ~aLGy~~pLv~n~EaLf~~~~~~~~~~~~~~~w~e~~e~~vr~ltmvAflL  723 (909)
T PF11145_consen  673 QALGYMIPLVLNFEALFKSSHNRQNIFLDSGGWLEVNEVMVRLLTMVAFLL  723 (909)
T ss_pred             HHHhccchhhcCHHHHcCcCCCCceEEeecCchhHHHHHHHHHHHHHHHHH
Confidence            9999999999999999993 3344455544444555555555  4567765


No 28 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=31.12  E-value=29  Score=29.10  Aligned_cols=22  Identities=45%  Similarity=1.017  Sum_probs=10.1

Q ss_pred             cCCCCCC--Ccccce-eCCCCcccc
Q 001005          541 KACPKGL--YGIFCE-ECPVGTYKN  562 (1192)
Q Consensus       541 k~CP~G~--yG~fC~-eCP~GtYK~  562 (1192)
                      +.|++|+  .+..|+ .||.++|.+
T Consensus        18 ~~C~~~~~~~~~~Cv~~C~~~~~~~   42 (49)
T cd00064          18 TSCRHGFYLDGGTCVSECPEGTYAD   42 (49)
T ss_pred             ccCcCccCCCCCcccccCCCCceec
Confidence            3444444  234444 455555443


No 29 
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]
Probab=30.05  E-value=51  Score=44.17  Aligned_cols=40  Identities=28%  Similarity=0.598  Sum_probs=28.4

Q ss_pred             CCCCCCCcccceeCCCCccccccCCCCCCcccCCCCCCCCCceE
Q 001005          542 ACPKGLYGIFCEECPVGTYKNVTGSDKSLCHQCPPQEFPHRAVY  585 (1192)
Q Consensus       542 ~CP~G~yG~fC~eCP~GtYK~~tGs~~~~C~pCp~~~~P~ra~y  585 (1192)
                      .|-|+--|-.|.+|.+|||-    -..+=|++|.=+..-+-..|
T Consensus       785 qCkPnVVGR~CdqCApGtyG----FGPsGCk~CdC~~~Gs~~~~  824 (1758)
T KOG0994|consen  785 QCKPNVVGRRCDQCAPGTYG----FGPSGCKACDCNSIGSLDKY  824 (1758)
T ss_pred             cccCccccccccccCCcccC----cCCccCcccccccccccccc
Confidence            56677779999999999994    34466999986544333333


No 30 
>KOG4260 consensus Uncharacterized conserved protein [Function unknown]
Probab=28.82  E-value=36  Score=39.26  Aligned_cols=21  Identities=43%  Similarity=1.048  Sum_probs=17.1

Q ss_pred             CCCCCCCcccceeCCCCcccc
Q 001005          542 ACPKGLYGIFCEECPVGTYKN  562 (1192)
Q Consensus       542 ~CP~G~yG~fC~eCP~GtYK~  562 (1192)
                      =||+|.||.-|.+||-|+=+.
T Consensus       131 CCp~gtyGpdCl~Cpggser~  151 (350)
T KOG4260|consen  131 CCPDGTYGPDCLQCPGGSERP  151 (350)
T ss_pred             ccCCCCcCCccccCCCCCcCC
Confidence            488888888888888887554


No 31 
>PF05268 GP38:  Phage tail fibre adhesin Gp38;  InterPro: IPR007932 This entry is represented by Bacteriophage T2, Gp38. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family contains several Gp38 proteins from T-even-like phages. Gp38, together with a second phage protein, Gp57, catalyses the organisation of Gp37 but is absent from the phage particle. Gp37 is responsible for receptor recognition [].
Probab=28.82  E-value=91  Score=35.21  Aligned_cols=14  Identities=29%  Similarity=0.620  Sum_probs=6.5

Q ss_pred             eeeCCceeEEEecC
Q 001005          468 LDIGDSAVLSSVGG  481 (1192)
Q Consensus       468 l~l~g~G~LsA~GG  481 (1192)
                      |.+.++|.|...||
T Consensus       143 LRI~N~GaIAgGGG  156 (260)
T PF05268_consen  143 LRINNNGAIAGGGG  156 (260)
T ss_pred             EEEecCCEEecCCC
Confidence            44445555544333


No 32 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=27.43  E-value=44  Score=32.77  Aligned_cols=25  Identities=28%  Similarity=0.557  Sum_probs=18.3

Q ss_pred             ccceeCCCCccccccCCCCCCcccCCCC
Q 001005          550 IFCEECPVGTYKNVTGSDKSLCHQCPPQ  577 (1192)
Q Consensus       550 ~fC~eCP~GtYK~~tGs~~~~C~pCp~~  577 (1192)
                      ..|.+|..|+|++..+   ..|.+|+.+
T Consensus         4 ~~Ct~C~~g~~~~~~~---~~C~~C~~~   28 (96)
T PTZ00382          4 AVCTSCDSDKKPNKDG---SGCVLCSVG   28 (96)
T ss_pred             cccCcCCCCCccCCCC---CcCCcCCCC
Confidence            3688999999887533   468888853


No 33 
>COG4907 Predicted membrane protein [Function unknown]
Probab=26.31  E-value=43  Score=41.02  Aligned_cols=8  Identities=38%  Similarity=0.073  Sum_probs=4.1

Q ss_pred             CcEEEEEE
Q 001005          295 LSFTLQIC  302 (1192)
Q Consensus       295 ~~fTLqI~  302 (1192)
                      ..+||.|.
T Consensus       451 ~v~~L~if  458 (595)
T COG4907         451 TVNTLFIF  458 (595)
T ss_pred             ccceeeeh
Confidence            44566553


No 34 
>COG1512 Beta-propeller domains of methanol dehydrogenase type [General function prediction only]
Probab=25.00  E-value=71  Score=36.76  Aligned_cols=12  Identities=50%  Similarity=1.041  Sum_probs=5.3

Q ss_pred             CCCCCCCCCCCC
Q 001005          356 GSGGGHGGKGGL  367 (1192)
Q Consensus       356 GgGGGHGG~GG~  367 (1192)
                      ||||+.||.|+.
T Consensus       257 gGGgS~GGGGas  268 (271)
T COG1512         257 GGGGSSGGGGAS  268 (271)
T ss_pred             CCCCCCCCCCCC
Confidence            444444444443


No 35 
>KOG4260 consensus Uncharacterized conserved protein [Function unknown]
Probab=24.36  E-value=43  Score=38.73  Aligned_cols=36  Identities=19%  Similarity=0.619  Sum_probs=27.6

Q ss_pred             cCCCCCCCcccceeCCCCccccccCCCCCCcccCCC
Q 001005          541 KACPKGLYGIFCEECPVGTYKNVTGSDKSLCHQCPP  576 (1192)
Q Consensus       541 k~CP~G~yG~fC~eCP~GtYK~~tGs~~~~C~pCp~  576 (1192)
                      =.|.+||.|..|.+|..++|...---....|++|..
T Consensus       170 CkC~~GY~Gp~C~~Cg~eyfes~Rne~~lvCt~Ch~  205 (350)
T KOG4260|consen  170 CKCETGYTGPLCRYCGIEYFESSRNEQHLVCTACHE  205 (350)
T ss_pred             ccccCCCCCccccccchHHHHhhcccccchhhhhhh
Confidence            489999999999999999997643223345777764


No 36 
>KOG4180 consensus Predicted kinase [General function prediction only]
Probab=23.40  E-value=1.3e+02  Score=35.84  Aligned_cols=28  Identities=32%  Similarity=0.502  Sum_probs=19.6

Q ss_pred             CCCCCCcccccccEEEEecCCCCcccCcc
Q 001005          823 RTDLPPCLHHRFPMSLIFGGDGSYMAPFS  851 (1192)
Q Consensus       823 r~dl~~~i~~~~Pm~IlfsGdGSf~~Pf~  851 (1192)
                      |.++... ..--.|+|-.||||+|+--=+
T Consensus        96 R~~lsq~-i~waD~VisvGGDGTfL~Aas  123 (395)
T KOG4180|consen   96 RNDLSQP-IRWADMVISVGGDGTFLLAAS  123 (395)
T ss_pred             hhhccCc-CchhhEEEEecCccceeehhh
Confidence            4444333 444578999999999987666


No 37 
>PF14946 DUF4501:  Domain of unknown function (DUF4501)
Probab=23.12  E-value=2.3e+02  Score=30.93  Aligned_cols=29  Identities=41%  Similarity=0.522  Sum_probs=21.0

Q ss_pred             HhCCch-hhHHHHHHHHHHHHHHHHHhhhh
Q 001005          621 TFGGPW-LFCLLLVGLLILLALVLSVARMK  649 (1192)
Q Consensus       621 tfGGp~-~F~lll~~llvLlalv~s~~R~k  649 (1192)
                      .+|||+ .-.|||=.|+|-++++++++-.-
T Consensus        83 ~~g~P~vAASL~LgTffIS~~LilSvA~FF  112 (180)
T PF14946_consen   83 HTGGPQVAASLFLGTFFISLGLILSVASFF  112 (180)
T ss_pred             cCCChhHHHHHHHHHHHHHHHHHHHHhhhe
Confidence            579998 55566557777788998877543


No 38 
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]
Probab=22.43  E-value=84  Score=43.29  Aligned_cols=36  Identities=36%  Similarity=0.866  Sum_probs=28.1

Q ss_pred             CCCCceEEccCCCCCCCcccce-----eCCCCccccccCCCCCCcccCC
Q 001005          532 GGENGTTTGKACPKGLYGIFCE-----ECPVGTYKNVTGSDKSLCHQCP  575 (1192)
Q Consensus       532 ~G~~GTI~gk~CP~G~yG~fC~-----eCP~GtYK~~tGs~~~~C~pCp  575 (1192)
                      +|.+|  |.-.||+||+|.+|+     +||.||+-.      ..|.||.
T Consensus      1734 p~a~G--Y~C~C~~g~~G~~Ce~~~dq~CPrGWWG~------P~CgpC~ 1774 (2531)
T KOG4289|consen 1734 PGAHG--YTCECPPGYTGPYCELRADQPCPRGWWGF------PTCGPCN 1774 (2531)
T ss_pred             CCCCc--eeEECCCcccCcchhhhccCCCCCcccCC------CCccCcc
Confidence            34455  457999999999995     899999843      4588885


No 39 
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=22.12  E-value=1.2e+02  Score=37.45  Aligned_cols=9  Identities=33%  Similarity=0.829  Sum_probs=4.9

Q ss_pred             cccCcccCCc
Q 001005          846 YMAPFSLQND  855 (1192)
Q Consensus       846 f~~Pf~L~sD  855 (1192)
                      |-.|| |..|
T Consensus       488 ~~gp~-i~ad  496 (641)
T KOG3915|consen  488 FPGPF-IFAD  496 (641)
T ss_pred             CCCcc-cccc
Confidence            44666 5544


No 40 
>PF04790 Sarcoglycan_1:  Sarcoglycan complex subunit protein;  InterPro: IPR006875 The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma and delta members [, ].; GO: 0007010 cytoskeleton organization, 0016012 sarcoglycan complex, 0016021 integral to membrane
Probab=21.38  E-value=8.8e+02  Score=28.04  Aligned_cols=59  Identities=17%  Similarity=0.274  Sum_probs=42.0

Q ss_pred             ceecCCCCCcccccCCcEE-EEEEEEEEEEeeeEEeccEEEEEecceEEEcc-CceEeecCCC
Q 001005          280 VELLHPPEDCNVNSSLSFT-LQICRVEDIVVDGLVEGSVVHFHRARTISVQS-SGAISASGMG  340 (1192)
Q Consensus       280 ~~~~~ppe~c~vn~s~~fT-LqI~rVeditv~g~i~GSvV~~~~a~tItI~~-~G~IsASGlG  340 (1192)
                      +..|.+|.+=++..+++-. |.+-.-|.+.+++. +| -|.+.+-..|.+++ +|.|.-+|.+
T Consensus       162 T~~Irs~~~~~L~leS~trsL~~~a~egV~i~a~-ag-~I~~~a~~di~L~S~~G~i~Lda~~  222 (264)
T PF04790_consen  162 TPRIRSPPNEDLRLESPTRSLSMRAPEGVHIEAK-AG-DIEASARQDISLNSTDGSIVLDAEG  222 (264)
T ss_pred             eccccCCCCcccccccCCcEEEEECCCCeEEEec-cC-cEEEEecCCEEEEecCCeEEEecCe
Confidence            3447778777888777776 77777888888885 33 34555667788877 6888777744


No 41 
>PF15496 DUF4646:  Domain of unknown function (DUF4646)
Probab=20.83  E-value=1.2e+02  Score=31.02  Aligned_cols=70  Identities=14%  Similarity=0.246  Sum_probs=46.8

Q ss_pred             hhhhhchHHHHHHHHHHHhhhhhhhhhhHHHHH------hH--HhhcchhHHHHHHHHHHHHHHHHHHHHhhcCchhhc
Q 001005          719 IKEIVYEGAFNSFVDEINAIATYHWWEGAIYSI------LA--ILAYPLAWSWQQWRRRMKLQRLREYVRSEYDHACLR  789 (1192)
Q Consensus       719 i~~iVyed~Fn~Fad~IN~laay~~We~~iy~i------Ls--vl~YPlaw~~lq~rRrkk~~rL~efv~seydh~clR  789 (1192)
                      ...=|.++++.+|.++++.-++..-+|.++-..      +.  +..|=.++.....+.+||-..+.++|. ..|+.|++
T Consensus        43 ~~~DVs~eDW~~F~~dl~~aa~ls~~~~~~~~~~~~~~~v~~Gi~~~~v~~~~~~~~~~~k~~~v~~~i~-~WN~~FF~  120 (123)
T PF15496_consen   43 ASHDVSEEDWTRFLNDLSEAASLSPSQSIVAGVGPIVMGVGFGIPAYLVAKAIRKAMKEKKRGEVESTID-QWNEGFFR  120 (123)
T ss_pred             hhcCCCHHHHHHHHHHHHHHHhcCcccceeeeeccccccccccchhhhhhHhhhhcccccchHHHHHHHH-HHHHHhcc
Confidence            444568999999999999988887666432221      11  233444555666777777778888886 56666654


Done!