BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001019
         (1188 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4FHH|A Chain A, Development Of Synthetically Accessible Non-Secosteroidal
           Hybrid Molecules Combining Vitamin D Receptor Agonism
           And Histone Deacetylase Inhibition
 pdb|4FHI|A Chain A, Development Of Synthetically Accessible Non-Secosteroidal
           Hybrid Molecules Combining Vitamin D Receptor Agonism
           And Histone Deacetylase Inhibition
 pdb|4G1D|A Chain A, Structural Basis For The Accommodation Of Bis- And
           Tris-Aromatic Derivatives In Vitamin D Nuclear Receptor
 pdb|4G1Y|A Chain A, Structural Basis For The Accommodation Of Bis- And
           Tris-Aromatic Derivatives In Vitamin D Nuclear Receptor
 pdb|4G1Z|A Chain A, Structural Basis For The Accommodation Of Bis- And
           Tris-Aromatic Derivatives In Vitamin D Nuclear Receptor
 pdb|4G20|A Chain A, Structural Basis For The Accommodation Of Bis- And
           Tris-Aromatic Derivatives In Vitamin D Nuclear Receptor
 pdb|4G21|A Chain A, Structural Basis For The Accommodation Of Bis- And
           Tris-Aromatic Derivatives In Vitamin D Nuclear Receptor
 pdb|4G2H|A Chain A, Structural Basis For The Accommodation Of Bis- And
           Tris-Aromatic Derivatives In Vitamin D Nuclear Receptor
          Length = 300

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 871 RITGEEEIPVGVVAVLTPDMPDVLSHVSIRARNNKVC 907
           ++  EE + +  + +L+PD P V  HV I A  +++C
Sbjct: 199 KLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLC 235


>pdb|2HBH|A Chain A, Crystal Structure Of Vitamin D Nuclear Receptor Ligand
           Binding Domain Bound To A Locked Side-Chain Analog Of
           Calcitriol And Src-1 Peptide
 pdb|2HC4|A Chain A, Crystal Structure Of The Lbd Of Vdr Of Danio Rerio In
           Complex With Calcitriol
 pdb|2HCD|A Chain A, Crystal Structure Of The Ligand Binding Domain Of The
           Vitamin D Nuclear Receptor In Complex With Gemini And A
           Coactivator Peptide
 pdb|3DR1|A Chain A, Side-Chain Fluorine Atoms Of Non-Steroidal Vitamin D3
           Analogs Stabilize Helix 12 Of Vitamin D Receptor
 pdb|3O1D|A Chain A, Structure-Function Study Of Gemini Derivatives With Two
           Different Side Chains At C-20, Gemini-0072 And
           Gemini-0097.
 pdb|3O1E|A Chain A, Structure-Function Of Gemini Derivatives With Two
           Different Side Chains At C-20, Gemini-0072 And
           Gemini-0097
          Length = 302

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 871 RITGEEEIPVGVVAVLTPDMPDVLSHVSIRARNNKVC 907
           ++  EE + +  + +L+PD P V  HV I A  +++C
Sbjct: 201 KLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLC 237


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,994,946
Number of Sequences: 62578
Number of extensions: 1388431
Number of successful extensions: 3248
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3245
Number of HSP's gapped (non-prelim): 3
length of query: 1188
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1078
effective length of database: 8,089,757
effective search space: 8720758046
effective search space used: 8720758046
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)