BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001025
         (1184 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4IFQ|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nup192,
            Residues 2 To 960 [scnup192(2-960)]
          Length = 970

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 1076 PTSNHMFSEEPVIDSTNSVELGGDTINVSLDDGKSQVDL 1114
            P  N++F+E+      N V++G D +++ L+ GK+Q +L
Sbjct: 828  PIFNYIFTEKIYKSIFNVVDVGVDQLSIELEGGKNQAEL 866


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.128    0.362 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,727,455
Number of Sequences: 62578
Number of extensions: 1470536
Number of successful extensions: 2297
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 2293
Number of HSP's gapped (non-prelim): 7
length of query: 1184
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1074
effective length of database: 8,089,757
effective search space: 8688399018
effective search space used: 8688399018
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 57 (26.6 bits)