BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 001025
(1184 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4IFQ|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nup192,
Residues 2 To 960 [scnup192(2-960)]
Length = 970
Score = 31.2 bits (69), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 13/39 (33%), Positives = 25/39 (64%)
Query: 1076 PTSNHMFSEEPVIDSTNSVELGGDTINVSLDDGKSQVDL 1114
P N++F+E+ N V++G D +++ L+ GK+Q +L
Sbjct: 828 PIFNYIFTEKIYKSIFNVVDVGVDQLSIELEGGKNQAEL 866
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.128 0.362
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,727,455
Number of Sequences: 62578
Number of extensions: 1470536
Number of successful extensions: 2297
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 2293
Number of HSP's gapped (non-prelim): 7
length of query: 1184
length of database: 14,973,337
effective HSP length: 110
effective length of query: 1074
effective length of database: 8,089,757
effective search space: 8688399018
effective search space used: 8688399018
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 57 (26.6 bits)