Citrus Sinensis ID: 001073

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160---

MYIKEICLEGFKSYASRTVVPGFDPYFNAITGLNGSGKSNILDSICFVLGITNLQQVRASNLQELVYKQGQAGITKATVSIVFDNSDRSRSPLGYEDHPEITVTRQIVVGGRNKYLINGKLAQPSQVQTLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMLEEAAGTRMYETKKEAALKTLEKKQSKVDEINNLLDQEILPALEKLRKERTQYMQWANGNAELDRLRRFCIAYEYVQAEKIRDSAVGEVDRIKAKIAEIDCNTERTRLEIQEMEKQVSNLTAEKEASMGGEVKALSGKVDALSQDLVREVSVLNNKDDTLRSEKENAEKIVRNIEDLKQAVEEKVSAVRKCEEGAADLKKKFEELSKGLEENEKEYQGVLAGKSSGNEEKCLEDQLADAKVTVGSAETELKQLKTKISHCEKELKEKTHQLMSKREEAVSVESELNARRKDVENVKLALESDRASEMAMAQKLKDEIRDLSAQLANVQFTYRDPVKNFDRAKVKGVVAKLIKVKDSSTMTALEVTAGGKLFNVIVDTESTGKQLLQNGDLRRRVTIIPLNKIQSHTVPPRVQQAAVRLVGKENAELALSLVGYSDELKTAMEYVFGSTFVCKSIDAAKEVAFSREIRTPSVTLEGDIFQPSGLLTGGSRRGGGDLLRQLHRLAAVESNLVIHQKRLSEIEAKIKELLPFQKKYMDLKAQLELKLYDLSLFQGRAEQNEHHKLSEIVKKIEQELEEAKSSAKEKQLLYENSVSAVSVLEKSIKEHDNNREGRLKDLEKKIKAIKVQIQSASKDLKGHENERERLVMEHEAIVKEHASLENQLASVRMQINGLTSEVEEQKNKVAFTRTNHDQAQSELNAIRLKMKECDSQISGILKEQQKLQDKLGEAKLERKRLENEVKRMEMEQKDCSTKVDKLIEKHAWIASEKQLFGRSGTDYDFESRDPYKAREELEKLQAEQSGLEKRVNKKVMAMFEKAEDEYNDLMSKKNIIENDKSKIKKVIEELDEKKKETLKVTWVKVNKDFGSIFSTLLPGTMAKLEPPEGGNFLDGLEVCVAFGGVWKQSLSELSGGQRSLLALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGRMIKTHFPHSQFIVVSLKEGMFNNANVLFRTKFVDGVSTVQRTVATKQIK

cEEEEEEEcccccccccccccccccccEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEccccccccccccccccEEEEEEEEEccccEEEEccccccHHHHHHHHHHccccccccccccccccHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccccccccHHHHHHHHHccccccEEEccHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHcccEEEEccHHHHHHHHHcccccccEEEccccEEccccCECcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccEEECccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccHHHHccccccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHEEEEEEcccEEEEEEEEEcccc

MYIKEICLEGFKSYASRTVVPGFDPYFNAITGLNGSGKSNILDSICFVLGITNLQQVRASNLQELVYKQGQAGITKATVSIVFDNSDRSRSPLGYEDHPEITVTRQIVVGGRNKYLINGKLAQPSQVQTLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMLEEAAGTRMYETKKEAALKTLEKKQSKVDEINNLLDQEILPALEKLRKERTQYMQWANGNAELDRLRRFCIAYEYVQAEKIRDSAVGEVDRIKAKIAEIDCNTE***********************************************************************************************************************************************************************************************************************LSAQLANVQFTYRDPVKNFDRAKVKGVVAKLIKVKDSSTMTALEVTAGGKLFNVIVDTESTGKQLLQNGDLRRRVTIIPLNKIQSHTVPPRVQQAAVRLVGKENAELALSLVGYSDELKTAMEYVFGSTFVCKSIDAAKEVAFSREIRTPSVTLEGDIFQPSGLLTGGSRRGGGDLLRQLHRLAAVESNLVIHQKRLSEIEAKIKELLPFQKKYMDLKAQLELKLYDLSLFQG*******************************************************************************************************************************************************************************************************VDKLIEKHAWIASEKQLFGRSG******************************VNKKVMAMFEKAEDEYNDLMSKKNIIENDKSKIKKVIEELDEKKKETLKVTWVKVNKDFGSIFSTLLPGTMAKLEPPEGGNFLDGLEVCVAFGGVWKQSLSELSGGQRSLLALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGRMIKTHFPHSQFIVVSLKEGMFNNANVLFRTKFVDGVSTVQRTVATK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYIKEICLEGFKSYASRTVVPGFDPYFNAITGLNGSGKSNILDSICFVLGITNLQQVRASNLQELVYKQGQAGITKATVSIVFDNSDRSRSPLGYEDHPEITVTRQIVVGGRNKYLINGKLAQPSQVQTLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMLEEAAGTRMYETKxxxxxxxxxxxxxxxxxxxxxLDQEILPALEKLRKERTQYMQWANGNAELDRLRRFCIAYEYVQAEKIRDSAVGEVDRIKAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxKEASMGGEVKALSGKVDALSQDLVREVSVLNNKDDTxxxxxxxxxxxxxxxxxxxxxxxxxxxxVRKCEEGxxxxxxxxxxxxxxxxxxxxxYQGVLAGKSSGNEEKCLEDQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVSVESELNARRKDVENVKLALESDxxxxxxxxxxxxxxxxxxxxxxxxxxxxYRDPVKNFDRAKVKGVVAKLIKVKDSSTMTALEVTAGGKLFNVIVDTESTGKQLLQNGDLRRRVTIIPLNKIQSHTVPPRVQQAAVRLVGKENAELALSLVGYSDELKTAMEYVFGSTFVCKSIDAAKEVAFSREIRTPSVTLEGDIFQPSGLLTGGSRRGGGDLLRQLHRxxxxxxxxxxxxxxxxxxxxxIKELLPFQKKYMDLKAQLELKLYDLSLFQGRAEQNExxxxxxxxxxxxxxxxxxxxxxxxxxxxYENSVSAVSVLEKSIKEHDNNREGRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISGILKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDKLIEKHAWIASEKQLFGRSGTDYDFESRDPYKAREELEKLQAEQSGLEKRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLKVTWVKVNKDFGSIFSTLLPGTMAKLEPPEGGNFLDGLEVCVAFGGVWKQSLSELSGGQRSLLALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGRMIKTHFPHSQFIVVSLKEGMFNNANVLFRTKFVDGVSTVQRTVATKQIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Structural maintenance of chromosomes protein 2-1	Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Also involved in chromosome segregation in meiosis.	confident	Q9C5Y4
Structural maintenance of chromosomes protein 2	May play a role in the conversion of interphase chromatin into condensed chromosomes.	probable	Q8IED2
Structural maintenance of chromosomes protein 2	Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.	probable	Q54PK4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 983-1005,1018-1042,1054-1160
View the alignment between query and template
View the model in PyMOL

Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 1-51,62-86,98-165
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 248-284
View the alignment between query and template
View the model in PyMOL

Template: 3L51, chain A
Confidence level:very confident
Coverage over the Query: 492-645
View the alignment between query and template
View the model in PyMOL

Template: 1GXL, chain A
Confidence level:very confident
Coverage over the Query: 506-671
View the alignment between query and template
View the model in PyMOL

Template: 3NWC, chain A
Confidence level:confident
Coverage over the Query: 522-573,596-719
View the alignment between query and template
View the model in PyMOL

Template: 3ZGX, chain A
Confidence level:probable
Coverage over the Query: 1-53,76-199
View the alignment between query and template
View the model in PyMOL

Template: 2B9C, chain A
Confidence level:probable
Coverage over the Query: 836-903
View the alignment between query and template
View the model in PyMOL

Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 326-383
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 415-454
View the alignment between query and template
View the model in PyMOL

Template: 3OJA, chain B
Confidence level:probable
Coverage over the Query: 733-765
View the alignment between query and template
View the model in PyMOL

Template: 3GHG, chain A
Confidence level:probable
Coverage over the Query: 355-477
View the alignment between query and template
View the model in PyMOL

Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 224-305
View the alignment between query and template
View the model in PyMOL

Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 811-881
View the alignment between query and template
View the model in PyMOL

Template: 1CII, chain A
Confidence level:probable
Coverage over the Query: 677-999
View the alignment between query and template
View the model in PyMOL