Citrus Sinensis ID: 001121

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150
MTPQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA
cccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccEEcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccHHcccccccccccccccccHHHcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEEccccHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccccEEEEcccHHHHHHHcccHccccccccccccccccccccccEccccccccccccccccccccccccccccccccEccccccccccEEEcccccEHHHHHccccccEEEEEEcccHHHHHHHHHHHHccccccccccccccccccHccccHHHccccccccccccccccccccccccEEEEEcccccccccHHHHHccccccccccccccccccccccccccccccccEccccccccccccccccccccccccEEEcccccEEEccccEccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEccccEEEcccccccccccccccccEEccccccEEEEEHHccccEccccccHHHHHHHHHHHHccccccHHccccccccccccccccEEEEEEccccccccccccccccccccccEccccccccccccccccHcHHHHHHEEccccccccEEccccEEEccccccccHEEcccccccccHHHcccccccccEcccccccccccccccccccccccccHccccccccccccccccccccccccccccccccEEccccEEEccccccccccEcccccccccccccccccccEEEcEccccccccccccccccccccccEEEEEEcccccccccccccccEcccccccccccccccccccEccccHHHHHHHHcccccccccccccccEcccccEEEEEHccccccccccccccccccccccccccccEccccHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccccccccc
mtpqmaigfncgeaanfgtpqWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFIsrvprsllpgarssrlRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLwnadllpcqskesqmpsanetvsttpgetvpnnpyekhndhnnlLDEMNVYMEAlndpymgdddisrdfhidsgALACVACGILGFPFMSVVQLSERASIELLADLVkegpgvselknthhhtnldgsvkssvsddlclvpdisllqkdlsvpsitkssriwntsnkylrpriFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEeigspfnyidvpldaaseeDLHLIDLAiddgeldecREDWTSKLGINLRHCvkvrknspsmrvQHALSlgdlfsekslssdfsKIKWQFRRSRSKIklygrahskpcqnieikkdevtgrkldgatvkkEEKLIQYSRRkfkqkpdlstgacgdqvhprellpevsaatcdhldghnrsdfeinpdgtgnsgsisagsihspigmseglhdipvreatsnlslnyspsrvaDSLATATLVVDSIVQNDTESMKELNIEGDIFHMATcksaemqqnsgtdvtsekteishhtvasnegsiimrsdqitESMTiknekcnlaseghcrkiedlapdnscmiSEACDhmisdnevrqnvqstnggndvepiscdhklideppastgescedmREISTAESLQDNLqhernigngsneeLVSSSVTmmiqptsapmeisevpskecaaadllnvgtkQKLISSCVsrmevdqpsplkvggcsevpieictkedsgadmtldprtqlqnhTTAEAIMDELVcnssaqleeneripasvaacseesngifaeekmdfdmtigtqtknatseepkptslipidqpipAVIRKYSRtrresysaekfcngneaysskdnkerecnesnledpsfsagkgrkrnRELERLtenkfngsgfirspceglrsragkdaantsEVDIRKIAEKRATKtmrnresvpapcqdkkkilkghhrcdldgcrmsFETKRELSlhkrnrcphegcgkrfsshkYAIIHQRvhdderplkcpwkgcsmsfKWAWARTEHIRvhtgerpykckfegcglsfrfVSDISrhrrktghyenlsa
MTPQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPrsllpgarssrlrdrqkEERELLVkkafvedilkeNNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDIsllqkdlsvpsitkssriwntsnkYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWtsklginlrhcvkvrknspsmRVQHALSlgdlfsekslssdfskikwqfrrsrskiklygrahskpcqnieikkdevtgrkldgatvkkeekliqysrrkfkqkpdlstgacgdqvhPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEIShhtvasnegsiimrSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRmevdqpsplkvggcseVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKnatseepkptslipidqpipAVIRKYSRTRresysaekfcngneaysskdnkerecnesnledpsfsagkgrkrnrelerltenkfngsgfirspceglrsragkdaantsevdirkiaekratktmrnresvpapcqdkkkilkghhrcdldgcrMSFETKRElslhkrnrcphegcgkrfsshKYAIIHQRvhdderplkcPWKGCSMSFKWAWARTEHIRvhtgerpykckfegcGLSFRfvsdisrhrrktghyenlsa
MTPQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA
*****AIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPR********************LLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPC************************************LDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKE***********************VSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRK********HALSLGDLF********FSKIKWQFRRSRSKIKLYGRA********************************************************************************************************************************ADSLATATLVVDSIVQND****KELNIEGDIFHMATC********************************************************HCRKIE*L****SCMISEAC***************************************************************************************************AAADLLNVGTKQKLISSCVS**********KVGGCSEVPIEICT***********************************************************************************************VI************************************************************************************************************************LKGHHRCDLDGCRMSFET*****L***NRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDI***************
**PQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVP**********************LVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADL********************************************VYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSE***************************************************************RIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHC****************SLGDLFSEKSLSSDFSKIKWQ******************************************************************************************************************************************************************************************************************IIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACD*************************************************************************************************************************************************************************************************************************************************YSRTR**************AYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPC**LRSRAGKDAANTSEVDIRKIAEKRATKTM**R******CQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKT********
MTPQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGA***********ERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQS*****************ETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRK***********CGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAE********************VASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPP*************STAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQ***********TSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEA*****************************NRELERLTENKFNGSGFIRSPCEGL************EVDIRKIAEKRAT************CQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISR*************
*TPQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSA**********************HNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVK*****************************************LSV*SITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQ***S*SK*KLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACG*****************************I*PDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQN**TDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVG*K********S*M*V******************************************EAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDIS***RKT********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPQMAIGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1150 2.2.26 [Sep-21-2011]
Q6BDA01340 Probable lysine-specific yes no 0.367 0.315 0.543 1e-132
Q9STM31360 Lysine-specific demethyla no no 0.180 0.152 0.426 8e-48
P52747 638 Zinc finger protein 143 O yes no 0.081 0.147 0.435 1e-19
A6QQW0 613 Zinc finger protein 143 O yes no 0.081 0.153 0.435 1e-19
Q58DZ6 567 Zinc finger protein 143 O yes no 0.117 0.238 0.346 4e-19
O70230 638 Zinc finger protein 143 O yes no 0.081 0.147 0.425 1e-18
Q5XIU2 638 Zinc finger protein 143 O yes no 0.081 0.147 0.425 2e-18
Q91853 565 Zinc finger protein 143 O N/A no 0.092 0.187 0.407 6e-18
P36508 570 Zinc finger protein 76 OS no no 0.081 0.164 0.415 2e-17
B4F7E9 568 Zinc finger protein 76 OS no no 0.081 0.165 0.415 2e-17
>sp|Q6BDA0|ELF6_ARATH Probable lysine-specific demethylase ELF6 OS=Arabidopsis thaliana GN=ELF6 PE=1 SV=1 Back     alignment and function desciption
 Score =  474 bits (1219), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 254/467 (54%), Positives = 313/467 (67%), Gaps = 44/467 (9%)

Query: 8   GFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGA 67
           GFNCGEAANFGTPQWL VAKEAAVRRAAMNYLPMLSHQQLLYLLTMSF+SRVPRSLLPG 
Sbjct: 402 GFNCGEAANFGTPQWLNVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFVSRVPRSLLPGG 461

Query: 68  RSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQ-SKES 126
           RSSRLRDRQ+EERE LVK+AFVEDIL EN  LSVLL R+     V+W+ DLLP   +   
Sbjct: 462 RSSRLRDRQREEREFLVKRAFVEDILNENKNLSVLL-REPGSRLVMWDPDLLPRHSALAL 520

Query: 127 QMPSANETVSTTPGETVPNNPYEKHNDHNN-----LLDEMNVYMEALNDPYMGDDD-ISR 180
                    + +P         E H++  N     LL+E++++ME LND Y  DDD +  
Sbjct: 521 AAAGVAGASAVSPPAVAKKELEEGHSELQNKEKTSLLEELSLFMEKLNDVYYDDDDGLLN 580

Query: 181 DFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDG 240
           DF +D+G L CVACG+LGFPFMSVVQ SE+A    L DL                     
Sbjct: 581 DFQVDTGTLPCVACGVLGFPFMSVVQPSEKA----LKDL--------------------- 615

Query: 241 SVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQ 300
           S +   +D            +++   S  KS   W TS++Y+RPRIFCLEH  +++ +LQ
Sbjct: 616 SERQGETD-----------AQEIMTLSSEKSDCEWKTSSRYIRPRIFCLEHTIELQRLLQ 664

Query: 301 SKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGEL 360
           S+GG + LVICH D+QK KAHAA VAEE+  PF+Y DV L++AS+E+L LIDLAI+D E 
Sbjct: 665 SRGGLKFLVICHKDFQKFKAHAAIVAEEVKVPFSYDDVLLESASQEELSLIDLAIEDEEK 724

Query: 361 DECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSR 420
            E   DWTS+LGINLR+CVKVRKNSP+ ++QHALSLG LFS+ S   DF+ I+W  R+SR
Sbjct: 725 YEHSVDWTSELGINLRYCVKVRKNSPTKKIQHALSLGGLFSDTSQMLDFTTIRWLQRKSR 784

Query: 421 SKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRK 467
           SK K    +   PC+++E+K D      LD  T KKEEK+IQYSR+K
Sbjct: 785 SKAKPSSTSSFTPCEHLEVKADGKLRDNLDSQTGKKEEKIIQYSRKK 831
Acts probably as a histone 'Lys-4' (H3K4me) demethylase. Involved in transcriptional gene regulation. Acts as a repressor of the photoperiodic flowering pathway and of FT. Binds around the transcription start site of the FT locus.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 OS=Arabidopsis thaliana GN=REF6 PE=1 SV=1 Back     alignment and function description
>sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 Back     alignment and function description
>sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 Back     alignment and function description
>sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 Back     alignment and function description
>sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 Back     alignment and function description
>sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 Back     alignment and function description
>sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 Back     alignment and function description
>sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 Back     alignment and function description
>sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1150
255581769 1554 conserved hypothetical protein [Ricinus 0.928 0.687 0.467 0.0
356574611 1481 PREDICTED: probable lysine-specific deme 0.882 0.685 0.423 0.0
356533957 1499 PREDICTED: probable lysine-specific deme 0.886 0.680 0.423 0.0
296085997 1550 unnamed protein product [Vitis vinifera] 0.611 0.453 0.479 1e-175
225449012 1415 PREDICTED: probable lysine-specific deme 0.589 0.479 0.476 1e-170
449505721 1516 PREDICTED: probable lysine-specific deme 0.380 0.288 0.583 1e-143
449464394 1531 PREDICTED: probable lysine-specific deme 0.380 0.286 0.581 1e-143
79507158 1340 jumonji/Zn finger-class transcription fa 0.367 0.315 0.543 1e-130
357443191 1586 Zinc finger protein [Medicago truncatula 0.449 0.325 0.497 1e-129
297806397 1336 hypothetical protein ARALYDRAFT_487204 [ 0.449 0.386 0.486 1e-126
>gi|255581769|ref|XP_002531686.1| conserved hypothetical protein [Ricinus communis] gi|223528691|gb|EEF30705.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1190 (46%), Positives = 720/1190 (60%), Gaps = 122/1190 (10%)

Query: 8    GFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGA 67
            GFNCGEAANFGTPQWL VAKEAAVRRAAMNYLPMLSHQQLLYLLTMSF+SRVPRSLLPGA
Sbjct: 440  GFNCGEAANFGTPQWLKVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFVSRVPRSLLPGA 499

Query: 68   RSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQ 127
            RSSRLRDR KEEREL VKKAF+ED+LKENNILS LLG+ S  N V+WN DLLPC +K+ Q
Sbjct: 500  RSSRLRDRLKEERELSVKKAFIEDMLKENNILSALLGKDSICNVVIWNPDLLPCANKDFQ 559

Query: 128  MPSANETVSTTPGETVPNNPYEKHND---HNNLLDEMNVYMEALNDPYM-GDDDISRDFH 183
            +PS   TV+ T  E V ++ + K N     N+L  EM++YME LND Y+  D D+S DF 
Sbjct: 560  VPS---TVTATTEEIV-SSFHSKDNSSTTENDLFKEMSLYMETLNDLYVDDDGDLSDDFQ 615

Query: 184  IDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVK 243
            +DSG LACVACGILGFPFMSVVQ S+ A   LL     + P V E           GS++
Sbjct: 616  VDSGTLACVACGILGFPFMSVVQPSDTALAGLL-----DHPLVQE-----------GSIE 659

Query: 244  SSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKG 303
             S +  L                     SR WN S+K+LRPRIFCLEH  QIEE+L+SKG
Sbjct: 660  ESGNLPL---------------------SRGWNNSSKFLRPRIFCLEHGVQIEELLRSKG 698

Query: 304  GAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDEC 363
            GA +L+ICHSDYQKI+AHAAA+AEEI +PFNY ++PL++AS+EDL+LI +AID  + D+C
Sbjct: 699  GANMLLICHSDYQKIRAHAAAIAEEIDTPFNYNEIPLESASQEDLNLIYIAIDSEDHDDC 758

Query: 364  REDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKI 423
             EDWTSKL INLR+CVKVRKNSPS +VQHAL+LG LFS+++ SSDF  IKWQ RRSRS+I
Sbjct: 759  GEDWTSKLAINLRYCVKVRKNSPSNKVQHALALGGLFSDET-SSDFLNIKWQSRRSRSRI 817

Query: 424  KLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQV 483
            KL   AH KP   +E  K+ + G+  D   VK E KLIQY+RRK+K K D S  A  +Q 
Sbjct: 818  KLNRPAHCKPQNRVETNKENILGKTSDNVIVKTENKLIQYTRRKYKVKIDCS--ARWNQG 875

Query: 484  HPRE-LLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVR 542
             PR+  + +VS A C+ L  H R   +I P     S S +AGS  SPIGMS  LH++ V 
Sbjct: 876  CPRKHTMEQVSGANCEDLVKHTRKTSKITP-AVEISRSDAAGSCMSPIGMSGVLHEVQVL 934

Query: 543  EATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQN 602
            EAT  + LN +   V   + TA   ++ +V+     +++ N   ++  ++   S ++Q  
Sbjct: 935  EATDEMCLNSASLHVTGPVLTANPAIERVVRQVEIPLEKSNRFENVSTVSARVSFKIQHE 994

Query: 603  SGT------DVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIE 656
                     D  S  T +    V + E S +      T+++++ NE   +  EG  + + 
Sbjct: 995  EKVNGVIIEDEDSSGTNLCSQCVTAAERSEMEGEYHTTKNISLTNEAREIFCEGQYKILG 1054

Query: 657  D---LAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESC 713
            D   LA +   ++++   +M                     ++    L D+   S  ES 
Sbjct: 1055 DRDVLANELLILLTQLV-YMF--------------------LTLLDTLKDQHAVSLEEST 1093

Query: 714  EDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAAD 773
            E ++E    E   D LQHE  I +G N+EL+  ++ M  Q   +  E SE+  + C +A+
Sbjct: 1094 ECLQETCAEE---DKLQHEIEITSGINKELI-PNIVMNDQNHVSVAESSEILKQPCISAN 1149

Query: 774  LLNVGTKQKL--------------ISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGA 819
            L NV  K+ +               S  +++M +DQP+ +     SE  +   + ++   
Sbjct: 1150 LFNVTLKRGMQQGIQFTKERKKEHCSCSITQMGIDQPNAVSEETISEA-LGGTSAKNLWT 1208

Query: 820  DMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEE-------SNGIFA 872
               LD    L+  T   + ++ ++ NS+ Q+++   IP  V   SE        S G+  
Sbjct: 1209 GSILDFDMLLKVPTVNRSKVENIIPNSTNQIQD-PVIPVIVEEYSEVPRASSVFSVGLNL 1267

Query: 873  EEKM------------DFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRES 920
            E K+            D ++    QT   T+EE   + +  I Q  PA I++   T  ES
Sbjct: 1268 ETKLQKPIHSDDVVYRDDEVHEVCQTPRETNEERLLSHITQISQQSPAQIKRCFGTEEES 1327

Query: 921  YSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIR 980
            YS      G +  SS    E E  ES + DP  + GKGRKR  E+E LTENK N +GFI 
Sbjct: 1328 YSTGNVFKGQDDCSS---HELESAESAVVDPRSTVGKGRKRKNEVEHLTENKLNNNGFII 1384

Query: 981  SPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLD 1040
            SPCEGLR RAGKDA   + VDIRK A++        +     P   KK+I K  ++CDL+
Sbjct: 1385 SPCEGLRPRAGKDATFRNGVDIRKSAQENPMTKKARKPVNSVPNAKKKEIAKRSYKCDLE 1444

Query: 1041 GCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFK 1100
            GC MSFET+ EL LHKRNRCP+EGC KRF+SH+YAIIHQRVH+D+RPLKCPWK CSMSFK
Sbjct: 1445 GCPMSFETRAELLLHKRNRCPYEGCRKRFNSHRYAIIHQRVHEDDRPLKCPWKDCSMSFK 1504

Query: 1101 WAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA 1150
            WAWARTEH+RVHTGE+PYKCK EGCG +FRFVSD SRHRRKTGH  N  A
Sbjct: 1505 WAWARTEHMRVHTGEKPYKCKVEGCGRTFRFVSDFSRHRRKTGHCVNTPA 1554

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356574611|ref|XP_003555439.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Glycine max] Back     alignment and taxonomy information
>gi|356533957|ref|XP_003535524.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Glycine max] Back     alignment and taxonomy information
>gi|296085997|emb|CBI31438.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449012|ref|XP_002273747.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449505721|ref|XP_004162550.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449464394|ref|XP_004149914.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79507158|ref|NP_196044.2| jumonji/Zn finger-class transcription factor ELF6 [Arabidopsis thaliana] gi|75323150|sp|Q6BDA0.1|ELF6_ARATH RecName: Full=Probable lysine-specific demethylase ELF6; AltName: Full=Early flowering 6; AltName: Full=Jumonji domain-containing protein 11; AltName: Full=Probable lysine-specific histone demethylase ELF6 gi|50513175|gb|AAT77780.1| early flowering 6 [Arabidopsis thaliana] gi|332003334|gb|AED90717.1| jumonji/Zn finger-class transcription factor ELF6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357443191|ref|XP_003591873.1| Zinc finger protein [Medicago truncatula] gi|355480921|gb|AES62124.1| Zinc finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297806397|ref|XP_002871082.1| hypothetical protein ARALYDRAFT_487204 [Arabidopsis lyrata subsp. lyrata] gi|297316919|gb|EFH47341.1| hypothetical protein ARALYDRAFT_487204 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1150
TAIR|locus:21466531340 ELF6 "EARLY FLOWERING 6" [Arab 0.18 0.154 0.632 2.7e-120
TAIR|locus:5049556441360 REF6 "relative of early flower 0.183 0.155 0.427 4.5e-83
UNIPROTKB|G3MYC4168 G3MYC4 "Uncharacterized protei 0.093 0.636 0.427 2.3e-18
UNIPROTKB|E1C5B8 637 ZNF143 "Uncharacterized protei 0.093 0.167 0.435 9.9e-17
UNIPROTKB|E7EN86 610 ZNF143 "Zinc finger protein 14 0.093 0.175 0.427 3.2e-16
UNIPROTKB|E7ER34 637 ZNF143 "Zinc finger protein 14 0.093 0.167 0.427 3.5e-16
UNIPROTKB|P52747 638 ZNF143 "Zinc finger protein 14 0.093 0.167 0.427 3.5e-16
UNIPROTKB|E2RIV8 670 ZNF143 "Uncharacterized protei 0.093 0.159 0.427 6.3e-16
UNIPROTKB|A6QQW0 613 ZNF143 "Zinc finger protein 14 0.093 0.174 0.427 6.8e-16
UNIPROTKB|F1RZ10 546 ZNF76 "Uncharacterized protein 0.186 0.393 0.306 1.1e-15
TAIR|locus:2146653 ELF6 "EARLY FLOWERING 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 642 (231.1 bits), Expect = 2.7e-120, Sum P(2) = 2.7e-120
 Identities = 136/215 (63%), Positives = 158/215 (73%)

Query:     8 GFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGA 67
             GFNCGEAANFGTPQWL VAKEAAVRRAAMNYLPMLSHQQLLYLLTMSF+SRVPRSLLPG 
Sbjct:   402 GFNCGEAANFGTPQWLNVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFVSRVPRSLLPGG 461

Query:    68 RSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQ 127
             RSSRLRDRQ+EERE LVK+AFVEDIL EN  LSVLL R+     V+W+ DLLP  S  + 
Sbjct:   462 RSSRLRDRQREEREFLVKRAFVEDILNENKNLSVLL-REPGSRLVMWDPDLLPRHSALAL 520

Query:   128 MPSANETVSTTPGETVPNNPYEK-HNDHNN-----LLDEMNVYMEALNDPYMGDDD-ISR 180
               +     S      V     E+ H++  N     LL+E++++ME LND Y  DDD +  
Sbjct:   521 AAAGVAGASAVSPPAVAKKELEEGHSELQNKEKTSLLEELSLFMEKLNDVYYDDDDGLLN 580

Query:   181 DFHIDSGALACVACGILGFPFMSVVQLSERASIEL 215
             DF +D+G L CVACG+LGFPFMSVVQ SE+A  +L
Sbjct:   581 DFQVDTGTLPCVACGVLGFPFMSVVQPSEKALKDL 615
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0048577 "negative regulation of short-day photoperiodism, flowering" evidence=IMP
GO:0048579 "negative regulation of long-day photoperiodism, flowering" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0009741 "response to brassinosteroid stimulus" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0033169 "histone H3-K9 demethylation" evidence=IMP
GO:0009630 "gravitropism" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:504955644 REF6 "relative of early flowering 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYC4 G3MYC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5B8 ZNF143 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7EN86 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER34 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P52747 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIV8 ZNF143 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQW0 ZNF143 "Zinc finger protein 143" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZ10 ZNF76 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1150
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information 
 Score = 36.6 bits (85), Expect = 0.002
 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 2/23 (8%)

Query: 1107 EHIRVHTGERPYKCKFEGCGLSF 1129
             H+R HTGE+PYKC    CG SF
Sbjct: 4    RHMRTHTGEKPYKCPV--CGKSF 24

Length = 26

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1150
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.86
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.82
KOG3608 467 consensus Zn finger proteins [General function pre 99.49
KOG3608 467 consensus Zn finger proteins [General function pre 99.39
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.39
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.34
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.32
KOG3576267 consensus Ovo and related transcription factors [T 99.31
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.26
KOG3576267 consensus Ovo and related transcription factors [T 99.18
PLN03086567 PRLI-interacting factor K; Provisional 98.74
PHA00733128 hypothetical protein 98.54
PLN03086567 PRLI-interacting factor K; Provisional 98.5
PHA0276855 hypothetical protein; Provisional 98.01
PHA0276855 hypothetical protein; Provisional 97.99
KOG0958690 consensus DNA damage-responsive repressor GIS1/RPH 97.97
KOG1246904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 97.87
KOG3993500 consensus Transcription factor (contains Zn finger 97.81
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.74
PHA00733128 hypothetical protein 97.68
KOG3993 500 consensus Transcription factor (contains Zn finger 97.34
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.26
PHA0061644 hypothetical protein 96.97
PHA0073279 hypothetical protein 96.96
PHA0061644 hypothetical protein 96.85
COG5189423 SFP1 Putative transcriptional repressor regulating 96.78
PHA0073279 hypothetical protein 96.69
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.67
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.62
COG5189423 SFP1 Putative transcriptional repressor regulating 95.86
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.71
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.68
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 95.27
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 95.17
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.43
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 94.23
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 93.77
COG5048467 FOG: Zn-finger [General function prediction only] 93.35
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 93.25
COG5048467 FOG: Zn-finger [General function prediction only] 92.97
smart0035526 ZnF_C2H2 zinc finger. 91.83
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 91.59
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 90.78
PRK04860160 hypothetical protein; Provisional 89.16
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 88.45
smart0035526 ZnF_C2H2 zinc finger. 88.31
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 85.27
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 85.11
PRK04860160 hypothetical protein; Provisional 83.92
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 83.01
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.61
KOG2893 341 consensus Zn finger protein [General function pred 80.01
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information 
Probab=99.86  E-value=2.4e-22  Score=216.93  Aligned_cols=133  Identities=26%  Similarity=0.454  Sum_probs=120.3

Q ss_pred             CCccCccCccCCCchhHHHHHhhccccCccCCCCCCCCCcccccccCCCCceeccCCCCCCcccChHHHHhHhhcc---C
Q 001121          984 EGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNR---C 1060 (1150)
Q Consensus       984 ~~~Cs~CGK~F~sks~Lk~H~r~eKpy~K~F~srssL~~~H~~r~Ht~eKpykC~~~~CGKsFssks~Lk~H~r~H---c 1060 (1150)
                      .+.|+.|||.+.+.++|.+|+..+.+-                   ...+-|.|.  .|||.|.+...|+.|+++|   |
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~-------------------~s~ka~~C~--~C~K~YvSmpALkMHirTH~l~c  188 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSL-------------------DSKKAFSCK--YCGKVYVSMPALKMHIRTHTLPC  188 (279)
T ss_pred             ceeccccccccccccccchhhcccccc-------------------cccccccCC--CCCceeeehHHHhhHhhccCCCc
Confidence            378889999999999999998533221                   114557899  9999999999999999998   8


Q ss_pred             CCCCCCCccCChhHHHhhhhhccCCCCccCCCCcCCccccChhHHHHHHhhcCCCCcccCCCCCCCCcccChhHHHHHHH
Q 001121         1061 PHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRR 1140 (1150)
Q Consensus      1061 ~Ce~CGKsFssks~Lk~H~r~HtgeKpfkCp~e~CgKsFssks~Lk~HmRtHtGEKPYkC~v~GCGKsFsskS~LkrH~R 1140 (1150)
                      .|.+|||.|.+...|+-|+|+|+|||||.|+  .|+|.|..+++|+.||++|.+.|+|+|..  |+|.|...+.|.+|..
T Consensus       189 ~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~--hC~kAFADRSNLRAHmQTHS~~K~~qC~~--C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  189 ECGICGKAFSRPWLLQGHIRTHTGEKPFSCP--HCGKAFADRSNLRAHMQTHSDVKKHQCPR--CGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccccccccccchHHhhcccccccCCCCccCC--cccchhcchHHHHHHHHhhcCCccccCcc--hhhHHHHHHHHHHhhh
Confidence            9999999999999999999999999999995  59999999999999999999999999999  9999999999999986


Q ss_pred             H
Q 001121         1141 K 1141 (1150)
Q Consensus      1141 k 1141 (1150)
                      .
T Consensus       265 S  265 (279)
T KOG2462|consen  265 S  265 (279)
T ss_pred             h
Confidence            4

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG0958 consensus DNA damage-responsive repressor GIS1/RPH1, jumonji superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1150
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-11
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-11
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-08
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 4e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-05
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 3e-05
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 4e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 2e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-04
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure 
Iteration: 1

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 47/106 (44%), Gaps = 4/106 (3%)
Query: 1037 CDLDGCRMSFETKRELSLHKRNRCPH----EGCGKRFSSHKYAIIHQRVHDDERPLKCPW 1092
            C   GC   F     +  H     P       CGK F        HQ VH  E+P +C +
Sbjct: 8    CPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTF 67
Query: 1093 KGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRH 1138
            +GC   F   +    H+R+HTG+RPY C F+GC   F   +++  H
Sbjct: 68   EGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSH 113
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1150
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-24
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-21
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 4e-17
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-16
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-05
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 7e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
 Score =  104 bits (263), Expect = 3e-26
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 8/112 (7%)

Query: 1037 CDLDGCRMSFETKRELSLHKR-------NRCPHEGCGKRFSSHKYAIIHQRVHDDERPLK 1089
                     F+ +  L +H R       ++C  EGC K +S  +    H R H  E+P  
Sbjct: 40   GGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYM 99

Query: 1090 CPWKGCSMSFKWAWARTEHI-RVHTGERPYKCKFEGCGLSFRFVSDISRHRR 1140
            C  +GCS +F  A  R +H  R H+ E+PY CK  GC   +   S + +H +
Sbjct: 100  CEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVK 151
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1150
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.9
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.86
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.85
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.83
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.8
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.79
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.77
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.75
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.72
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.69
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.66
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.65
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.63
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.62
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.6
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.6
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.58
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.57
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.56
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.56
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.56
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.55
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.54
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.53
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.52
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.51
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.5
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.44
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.43
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.43
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.4
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.4
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.39
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.37
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.35
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.35
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.35
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.32
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.3
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.3
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.28
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.27
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.24
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.21
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.2
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.17
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.16
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.13
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.11
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.07
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.01
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.01
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.98
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.97
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.96
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.94
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.92
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.91
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.9
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.88
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.87
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.86
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.85
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.84
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.83
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.82
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.82
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.82
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.81
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.8
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.8
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.8
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.79
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.78
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.78
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.76
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.75
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.75
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.74
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.73
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.73
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.71
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.7
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.68
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.66
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.66
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.66
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.66
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.65
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.64
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.64
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.63
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.63
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.61
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.6
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.6
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.59
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.58
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.58
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.55
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.54
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.53
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.53
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.52
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.51
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.49
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.49
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.48
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.47
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.47
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.47
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.47
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.47
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.47
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.47
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.47
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.46
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.46
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.46
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.46
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.46
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.46
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.46
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.46
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.46
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.46
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.46
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.45
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.45
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.45
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.45
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.45
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.45
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.45
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.44
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.44
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.44
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.44
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.44
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.44
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.44
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.44
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.44
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.44
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.43
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.43
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.43
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.43
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.43
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.43
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.43
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.43
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.43
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.43
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.43
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.43
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.43
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.43
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.42
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.42
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.42
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.42
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.42
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.42
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.42
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.42
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.42
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.42
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.41
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.41
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.41
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.41
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.41
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.4
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.4
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.4
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.4
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.39
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.39
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.39
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.39
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.39
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.39
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.39
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.39
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.39
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.38
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.38
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.38
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.38
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.37
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.37
3avr_A531 Lysine-specific demethylase 6A; cupin superfamily, 98.37
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.36
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.36
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.35
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.35
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.35
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.29
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.23
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.21
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.21
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.2
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.2
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.15
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.15
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.12
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.07
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.05
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.99
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 97.99
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.95
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 97.95
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.93
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.93
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.91
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.9
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.89
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.87
2ox0_A381 JMJC domain-containing histone demethylation PROT; 97.85
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.83
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.81
3dxt_A354 JMJC domain-containing histone demethylation PROT; 97.81
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.79
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.77
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.77
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.76
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.75
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.73
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.72
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.71
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.71
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.71
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.7
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.69
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.68
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.68
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.65
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.63
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.63
4ask_A510 Lysine-specific demethylase 6B; oxidoreductase, KD 97.58
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.57
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.56
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.52
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.51
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.48
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.46
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.35
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.28
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.28
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.27
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.22
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.21
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.2
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.2
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.2
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.2
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.18
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.18
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.16
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.15
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.14
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.1
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.1
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.06
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.05
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.05
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.04
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.02
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.0
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.94
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.99
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.98
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.95
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.93
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.88
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.87
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.84
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.84
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.84
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.72
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.7
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.63
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.54
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.39
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 91.2
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.49
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 88.71
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 88.39
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 87.17
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 83.71
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.90  E-value=2.8e-25  Score=224.33  Aligned_cols=156  Identities=28%  Similarity=0.485  Sum_probs=130.4

Q ss_pred             CccCccCccCCCchhHHHHHh---hcccc-----CccCCCCCCCCCcccccccCCCCceeccCCCCCCcccChHHHHhHh
Q 001121          985 GLRSRAGKDAANTSEVDIRKI---AEKRA-----TKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHK 1056 (1150)
Q Consensus       985 ~~Cs~CGK~F~sks~Lk~H~r---~eKpy-----~K~F~srssL~~~H~~r~Ht~eKpykC~~~~CGKsFssks~Lk~H~ 1056 (1150)
                      +.|+.|++.|.....|..|++   +.+++     ++.|.....| ..| ++.|.+.++|.|.  .|++.|.+...|..|+
T Consensus        22 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l-~~H-~~~h~~~~~~~C~--~C~~~f~~~~~l~~H~   97 (190)
T 2i13_A           22 YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDL-TRH-QRTHTGEKPYKCP--ECGKSFSQRANLRAHQ   97 (190)
T ss_dssp             ---------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHH-HHH-HHHHHCCCCEECT--TTCCEESCHHHHHHHH
T ss_pred             CcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHH-HHH-HHhcCCCCCccCc--ccCCccCCHHHHHHHH
Confidence            566799999999999999998   33444     8888888888 777 5678889999999  9999999999999999


Q ss_pred             hcc-----CCCCCCCCccCChhHHHhhhhhccCCCCccCCCCcCCccccChhHHHHHHhhcCCCCcccCCCCCCCCcccC
Q 001121         1057 RNR-----CPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRF 1131 (1150)
Q Consensus      1057 r~H-----c~Ce~CGKsFssks~Lk~H~r~HtgeKpfkCp~e~CgKsFssks~Lk~HmRtHtGEKPYkC~v~GCGKsFss 1131 (1150)
                      +.|     |.|+.|++.|.+...|..|+++|+++++|.|  ..|++.|.+...|..|+++|++++||.|++  |++.|.+
T Consensus        98 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C--~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~--C~~~f~~  173 (190)
T 2i13_A           98 RTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKC--PECGKSFSREDNLHTHQRTHTGEKPYKCPE--CGKSFSR  173 (190)
T ss_dssp             HHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEEC--TTTCCEESCHHHHHHHHHHHHCCCCEECTT--TCCEESS
T ss_pred             HhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeEC--CCCCcccCCHHHHHHHHHhcCCCCCeECCC--CCCccCC
Confidence            875     8999999999999999999999999999999  569999999999999999999999999999  9999999


Q ss_pred             hhHHHHHHHHhCCCCCC
Q 001121         1132 VSDISRHRRKTGHYENL 1148 (1150)
Q Consensus      1132 kS~LkrH~RkHh~~kk~ 1148 (1150)
                      ...|.+|+++|++.++|
T Consensus       174 ~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          174 RDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHHHHHHHTTC------
T ss_pred             HHHHHHHHHhcCCCCCC
Confidence            99999999999988775
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ox0_A JMJC domain-containing histone demethylation PROT; double-stranded beta helix, demethylase, oxygenase, SGC, STR genomics, structural genomics consortium, oxidoreductase; HET: MLY ALY OGA; 1.95A {Homo sapiens} PDB: 2oq7_A* 2os2_A* 2ot7_A* 2oq6_A* 2vd7_A* 2ybk_A* 2ybp_A* 2ybs_A* 3njy_A* 3pdq_A* 3u4s_A* 2p5b_A* 2q8c_A* 2q8d_A* 2q8e_A* 2gp5_A* 2gp3_A* 2wwj_A* 2pxj_A* 2xml_A* Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxt_A JMJC domain-containing histone demethylation PROT; JMJD2D, histone demethylase, H3K9, jumonji domain-CONT protein 2D, oxidoreductase; 1.80A {Homo sapiens} PDB: 3dxu_A* 4hon_A* 4hoo_A 2w2i_A* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* 4eyu_A* 4ez4_A* 4ezh_A* Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1150
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-11
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-09
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 4e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d2glia233 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.3 bits (136), Expect = 4e-11
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 1089 KCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKF 1122
             CP   C  SF +     EH+++H+  R Y C+F
Sbjct: 3    SCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEF 36
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1150
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.28
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.04
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.64
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.57
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.54
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.53
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.53
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.51
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.51
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.46
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.43
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.42
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.38
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.35
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.32
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.31
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.25
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.24
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.22
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.22
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.2
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.2
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.17
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.15
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.13
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.06
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.06
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.02
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.0
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.9
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.87
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.74
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.63
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.5
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.17
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.83
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.71
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.67
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.64
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.55
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.54
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.5
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.45
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.16
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.13
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.12
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.78
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.72
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.64
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 95.45
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.32
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.24
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.16
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.69
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.39
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.3
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.21
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.04
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 93.78
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 93.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.49
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 93.47
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.14
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 92.55
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 92.2
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.03
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.88
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 91.75
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 91.58
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 91.22
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.08
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.04
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.56
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 90.28
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.89
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 89.44
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 88.72
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.15
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 86.41
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 85.23
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.42
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 82.96
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 82.2
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 80.63
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 80.3
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 80.26
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.28  E-value=8e-13  Score=108.78  Aligned_cols=53  Identities=30%  Similarity=0.723  Sum_probs=50.0

Q ss_pred             CCCccCCCCcCCccccChhHHHHHHhhcCCCCcccCCCCCCCCcccChhHHHHHHHHh
Q 001121         1085 ERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKT 1142 (1150)
Q Consensus      1085 eKpfkCp~e~CgKsFssks~Lk~HmRtHtGEKPYkC~v~GCGKsFsskS~LkrH~RkH 1142 (1150)
                      +|||.|  + ||+.|.....|..|+++|+|++||.|.+  ||++|...+.|.+|+++|
T Consensus         1 EK~y~C--~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC--Q-CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC--T-TSCEESSHHHHHHHHHHHSCCCSEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC--C-CCCeECCHHHhHHHhhccccccCCcCCC--cCCEecCHHHHHHHHhcC
Confidence            589999  6 9999999999999999999999999999  999999999999999887
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure