BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001182
         (1131 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4IFQ|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nup192,
           Residues 2 To 960 [scnup192(2-960)]
          Length = 970

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 961 PTSNHMFSEEPVIDSTNSVELGGDTINVSLDDGKSQVDL 999
           P  N++F+E+      N V++G D +++ L+ GK+Q +L
Sbjct: 828 PIFNYIFTEKIYKSIFNVVDVGVDQLSIELEGGKNQAEL 866


>pdb|1UUL|A Chain A, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|B Chain B, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|C Chain C, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|D Chain D, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|E Chain E, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|F Chain F, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|G Chain G, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|H Chain H, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|I Chain I, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
 pdb|1UUL|J Chain J, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In
            The Reduced State
          Length = 202

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 1065 LFVREPVQGRKVLALDHLLVGKTRKEASRMFFETLVLKTKDYIHVEQARPLDNINIKPGA 1124
            LF+ +P Q  + + ++ L VG+   EA R+         K +  VE+   +   N KPG 
Sbjct: 130  LFIIDPKQNLRQITVNDLPVGRDVDEALRL--------VKAFQFVEKHGEVCPANWKPGD 181

Query: 1125 KLMKAD 1130
            K MK D
Sbjct: 182  KTMKPD 187


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.129    0.363 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,822,538
Number of Sequences: 62578
Number of extensions: 1386773
Number of successful extensions: 2158
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 2153
Number of HSP's gapped (non-prelim): 10
length of query: 1131
length of database: 14,973,337
effective HSP length: 109
effective length of query: 1022
effective length of database: 8,152,335
effective search space: 8331686370
effective search space used: 8331686370
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)