BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001204
         (1124 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DZX|A Chain A, Crystal Structure Of The Rabgap Domain Of Human Tbc1d22b
          Length = 346

 Score = 29.6 bits (65), Expect = 9.0,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 485 EYFDGFREAYDSRNRELVRHEAPFMNVAHDNIPEGNGLLPF 525
           EYF    + YDSRN E   H+  +  + H +IP  N L+P 
Sbjct: 85  EYFGFIEQYYDSRNEE--HHQDTYRQI-HIDIPRTNPLIPL 122


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.131    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,993,817
Number of Sequences: 62578
Number of extensions: 1414762
Number of successful extensions: 2339
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 2310
Number of HSP's gapped (non-prelim): 27
length of query: 1124
length of database: 14,973,337
effective HSP length: 109
effective length of query: 1015
effective length of database: 8,152,335
effective search space: 8274620025
effective search space used: 8274620025
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)