BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 001216
         (1122 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IA7|A Chain A, Crystal Structure Of Calg4, The Calicheamicin
           Glycosyltransferase
 pdb|3IA7|B Chain B, Crystal Structure Of Calg4, The Calicheamicin
           Glycosyltransferase
          Length = 402

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 257 ALEPYARLFHRYYAFATPSATQRLLLGLLEAPPSWAPDALDAAVQLVEL 305
           + +P+A  F   +AF  P+ T R      +  P W P   DA V LV L
Sbjct: 196 SFQPFAETFDERFAFVGPTLTGR------DGQPGWQPPRPDAPVLLVSL 238


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.133    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,814,652
Number of Sequences: 62578
Number of extensions: 1170041
Number of successful extensions: 2234
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 2233
Number of HSP's gapped (non-prelim): 4
length of query: 1122
length of database: 14,973,337
effective HSP length: 109
effective length of query: 1013
effective length of database: 8,152,335
effective search space: 8258315355
effective search space used: 8258315355
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)