Citrus Sinensis ID: 001226

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------112
MLLLISYYVLFSLNQFLALSVSSPPSAISLVQFLDSLPKQSQSHLPWNQSVSTSAPCKWSGVSCYNNSSSLKALNLSGFGLSGVLNNSISYICKNQHLLSLDLSGNEFTGSIPKQLGNCGQLKTLLLNDNRFQGSIPPEIFKLKRLSWLDLGYNSLSGKIPPQVSLCYSLESIGFHNNFLNGELPNDICSLPKLKSLYLNTNNLTGLLPEFPNSCAILHLLIHENDFVGSLPTSLSNCRNLVEFSASSNNFGGAISPWIFKGLLQLEVLYLDDNNLEGQIPETLWGLENLQKLVLSANKLNGTISGQISHCNQLQVIALSRNNLVGQIPRSVGNLSSLNSLLLFNNRLQGTLPPELGNCGSLVDLRLQHNFIGGTIPPEICNLAKLEVLYLFNNRIEGAIPHQIGRMSKLVELALYNNRLTGRIPPDITRLRNLQFLSLAHNHLTGEVALELGKHFPYLSRLDLTGNSFYGPIPANICVGTNLFVLVLGNNRFNGSFPIEIGKCSSLRRVILSNNLLQGSLPATLERNPGVSFLDVRGNLLQGSIPPVFGFWSNLTMLDFSENRLSGSIPSELGNLENLQILRLSANKLDGRIPYELGKCTKMIKLDLSDNYLAGSIPSEVISLEKMQSLSLQENNLSGAIPDAFSSVQSLFELQLGSNIFDGSIPCSLSKLHHFSSILNVSNNKLSGKIPECLGNLDKLQILDLSSNSFSGEIPTEVNNMVSLYFVNISFNHFSGKLPASWTTLMVSYPGSFLGNSELCRQGNCGKNGRGHTRGRLAGIIIGVLLSVALLCALIYIMVVRVLRSKCFSDPSLLQDVQSRSEDLPRDLRYEDVIRATEGRIIGKGKHGTVYRTLSNNSRKHWAVKKLNRSETNFDVEIRTLSLVRHRNILRIVGSCTKDEHGFIVTEYMPGGTLFNVLHQNEPRLVLDWNTRYHIALGIAQGLSYLHYDCVPQIIHRDIKSDNILLDSELEPKIGDFGMSKLISDSHSSSTRSAIVGSLGYIAPENAYSTRLTEKSDVYSYGVILFELLFRKMPVDPSFGEDTDIVTWTRWKLQENHECICFLDREISFWDSDDQLKALRLLELALECTRQVADMRPSMREVVGFLIKLNDKNEGGMRT
cHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccCEEEEEEccccccEEEEEccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccCEcccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccEECcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEcccccCEEcccHHHHccccccEEEccccccECcccHHHHcccccccccccccccEEcccHHHHcccccccEEEcccccccccccHHcccccccccEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHcccccccccEEcccccccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHcccccEEccccccEEEEEECcccccEEEEEEEccccccHHHHHHHHccccccccccEEEEECcccccEEEEcccccccHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccc
MLLLISYYVLFSLNQFLALSVSSPPSAISLVQFLDSLPKQSQSHLPWNQSVSTSAPCKWSGVSCYNNSSSLKALNLSGFGLSGVLNNSISYICKNQHLLSLDLSGNEFTGSIPKQLGNCGQLKTLLLNDNRFQGSIPPEIFKLKRLSWLDLGYNSLSGKIPPQVSLCYSLESIGFHNNFLNGELPNDICSLPKLKSLYLNTNNLTGLLPEFPNSCAILHLLIHENDFVGSLPTSLSNCRNLVEFSASSNNFGGAISPWIFKGLLQLEVLYLDDNNLEGQIPETLWGLENLQKLVLSANKLNGTISGQISHCNQLQVIALSRNNLVGQIPRSVGNLSSLNSLLLFNNRLQGTLPPELGNCGSLVDLRLQHNFIGGTIPPEICNLAKLEVLYLFNNRIEGAIPHQIGRMSKLVELALYNNRLTGRIPPDITRLRNLQFLSLAHNHLTGEVALELGKHFPYLSRLDLTGNSFYGPIPANICVGTNLFVLVLGNNRFNGSFPIEIGKCSSLRRVILSNNLLQGSLPATLERNPGVSFLDVRGNLLQGSIPPVFGFWSNLTMLDFSENRLSGSIPSELGNLENLQILRLSANKLDGRIPYELGKCTKMIKLDLSDNYLAGSIPSEVISLEKMQSLSLQENNLSGAIPDAFSSVQSLFELQLGSNIFDGSIPCSLSKLHHFSSILNVSNNKLSGKIPECLGNLDKLQILDLSSNSFSGEIPTEVNNMVSLYFVNISFNHFSGKLPASWTTLMVSYPGSFLGNSELCRQGNCGK***GHTRGRLAGIIIGVLLSVALLCALIYIMVVRVLRSKC****************LPRDLRYEDVIRATEGRIIGKGKHGTVYRTLSNNSRKHWAVKKLNRSETNFDVEIRTLSLVRHRNILRIVGSCTKDEHGFIVTEYMPGGTLFNVLHQNEPRLVLDWNTRYHIALGIAQGLSYLHYDCVPQIIHRDIKSDNILLDSELEPKIGDFGMSKLI**********AIVGSLGYIAPENAYSTRLTEKSDVYSYGVILFELLFRKMPVDPSFGEDTDIVTWTRWKLQENHECICFLDREISFWDSDDQLKALRLLELALECTRQVADMRPSMREVVGFLIKL**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLLISYYVLFSLNQFLALSVSSPPSAISLVQFLDSLPKQSQSHLPWNQSVSTSAPCKWSGVSCYNNSSSLKALNLSGFGLSGVLNNSISYICKNQHLLSLDLSGNEFTGSIPKQLGNCGQLKTLLLNDNRFQGSIPPEIFKLKRLSWLDLGYNSLSGKIPPQVSLCYSLESIGFHNNFLNGELPNDICSLPKLKSLYLNTNNLTGLLPEFPNSCAILHLLIHENDFVGSLPTSLSNCRNLVEFSASSNNFGGAISPWIFKGLLQLEVLYLDDNNLEGQIPETLWGLENLQKLVLSANKLNGTISGQISHCNQLQVIALSRNNLVGQIPRSVGNLSSLNSLLLFNNRLQGTLPPELGNCGSLVDLRLQHNFIGGTIPPEICNLAKLEVLYLFNNRIEGAIPHQIGRMSKLVELALYNNRLTGRIPPDITRLRNLQFLSLAHNHLTGEVALELGKHFPYLSRLDLTGNSFYGPIPANICVGTNLFVLVLGNNRFNGSFPIEIGKCSSLRRVILSNNLLQGSLPATLERNPGVSFLDVRGNLLQGSIPPVFGFWSNLTMLDFSENRLSGSIPSELGNLENLQILRLSANKLDGRIPYELGKCTKMIKLDLSDNYLAGSIPSEVISLEKMQSLSLQENNLSGAIPDAFSSVQSLFELQLGSNIFDGSIPCSLSKLHHFSSILNVSNNKLSGKIPECLGNLDKLQILDLSSNSFSGEIPTEVNNMVSLYFVNISFNHFSGKLPASWTTLMVSYPGSFLGNSELCRQGNCGKNGRGHTRGRLAGIIIGVLLSVALLCALIYIMVVRVLRSKCFSDPSLLQDVQSRSEDLPRDLRYEDVIRATEGRIIGKGKHGTVYRTLSNNSRKHWAVKKLNRSETNFDVEIRTLSLVRHRNILRIVGSCTKDEHGFIVTEYMPGGTLFNVLHQNEPRLVLDWNTRYHIALGIAQGLSYLHYDCVPQIIHRDIKSDNILLDSELEPKIGDFGMSKLISDSHSSSTRSAIVGSLGYIAPENAYSTRLTEKSDVYSYGVILFELLFRKMPVDPSFGEDTDIVTWTRWKLQENHECICFLDREISFWDSDDQLKALRLLELALECTRQVADMRPSMREVVGFLIKLNDKNEGGMRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable leucine-rich repeat receptor-like protein kinase At5g63930 probableQ9LVP0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 481-736
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 21-205
View the alignment between query and template
View the model in PyMOL
Template: 3O53, chain A
Confidence level:very confident
Coverage over the Query: 436-653,679-740
View the alignment between query and template
View the model in PyMOL
Template: 3O53, chain A
Confidence level:very confident
Coverage over the Query: 364-633
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 25-288,307-540,559-614
View the alignment between query and template
View the model in PyMOL
Template: 3A79, chain B
Confidence level:very confident
Coverage over the Query: 239-504,526-716
View the alignment between query and template
View the model in PyMOL
Template: 3OJA, chain B
Confidence level:very confident
Coverage over the Query: 359-464,489-655,681-762
View the alignment between query and template
View the model in PyMOL
Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 924-1112
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 826-1110
View the alignment between query and template
View the model in PyMOL
Template: 3RGX, chain A
Confidence level:confident
Coverage over the Query: 101-643
View the alignment between query and template
View the model in PyMOL
Template: 3SAY, chain A
Confidence level:probable
Coverage over the Query: 809-1055
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 769-777
View the alignment between query and template
View the model in PyMOL